Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NUX1

Protein Details
Accession B8NUX1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
169-191TCAMRRTLVSRKARKRRIAENAEHydrophilic
NLS Segment(s)
PositionSequence
180-184KARKR
329-377PAPPGFVPRGRGAYPARGGYGRGGPYGGPRGPPPGGRGSPMGSMRGGRG
Subcellular Location(s) plas 13, extr 11, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009571  SUR7/Rim9-like_fungi  
Gene Ontology GO:0005886  C:plasma membrane  
Pfam View protein in Pfam  
PF06687  SUR7  
Amino Acid Sequences MLLKPATPLTILLLIAFVLLLLSVISTPIVKGIPLATFENVDYGVFGYCKAGQCTNIHLGYTNDDLSDTGDDFNLPSSTRRSLSSILIVHPVAAFLTLICLCMAAAAHFHAPSHSPRYLLVLLILLLPTLLVSLLAFLVDILLFVPHLGWGGWIVLGATILLVSCGVVTCAMRRTLVSRKARKRRIAENAEMSGENYYNRQNAAAAAAGLNNPKPLNGEAKEPFVTGSPPGSDTGPTFATFRTTTHESDDDRTPLNSRTPPNDFPLPDPSYPTQMRDNGPPYNPSRDEFGNPLPPSGPYGPGPRMRPGPGDPRLRNQYSDGSMGSRRGPAPPGFVPRGRGAYPARGGYGRGGPYGGPRGPPPGGRGSPMGSMRGGRGGYRGPAPFGYGPNPGPRPMPPPEEERYDYDAPPDSMRQPSPGPIGMAVSPPDGSPIGQAIEMTPQPRRTGSAEPVPQEVLLGQQPHALSADGQPEPVSPSSLYSRTPSYVPPRAAWEQAERRPGHSPSPVHAYRSAETARTPHHAGSESAGYFEDADPRFANRNEPAVGNPRLPSALTPGSSAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.06
5 0.03
6 0.03
7 0.03
8 0.03
9 0.03
10 0.03
11 0.04
12 0.04
13 0.05
14 0.05
15 0.07
16 0.08
17 0.07
18 0.08
19 0.1
20 0.12
21 0.15
22 0.17
23 0.16
24 0.17
25 0.18
26 0.18
27 0.16
28 0.14
29 0.12
30 0.1
31 0.1
32 0.09
33 0.09
34 0.1
35 0.13
36 0.17
37 0.2
38 0.21
39 0.24
40 0.25
41 0.32
42 0.36
43 0.33
44 0.3
45 0.29
46 0.28
47 0.28
48 0.29
49 0.23
50 0.16
51 0.15
52 0.15
53 0.15
54 0.16
55 0.13
56 0.11
57 0.1
58 0.1
59 0.1
60 0.12
61 0.11
62 0.1
63 0.12
64 0.16
65 0.19
66 0.21
67 0.23
68 0.25
69 0.27
70 0.29
71 0.33
72 0.31
73 0.29
74 0.31
75 0.29
76 0.25
77 0.22
78 0.19
79 0.12
80 0.1
81 0.08
82 0.04
83 0.08
84 0.07
85 0.08
86 0.08
87 0.08
88 0.07
89 0.08
90 0.08
91 0.05
92 0.06
93 0.07
94 0.09
95 0.09
96 0.09
97 0.1
98 0.12
99 0.17
100 0.22
101 0.21
102 0.21
103 0.21
104 0.27
105 0.26
106 0.24
107 0.2
108 0.14
109 0.13
110 0.13
111 0.13
112 0.07
113 0.05
114 0.05
115 0.04
116 0.03
117 0.03
118 0.02
119 0.02
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.03
134 0.04
135 0.04
136 0.04
137 0.04
138 0.05
139 0.05
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.02
151 0.02
152 0.03
153 0.03
154 0.04
155 0.04
156 0.06
157 0.09
158 0.1
159 0.1
160 0.11
161 0.15
162 0.24
163 0.33
164 0.41
165 0.49
166 0.58
167 0.69
168 0.78
169 0.82
170 0.8
171 0.8
172 0.81
173 0.79
174 0.75
175 0.7
176 0.63
177 0.56
178 0.49
179 0.4
180 0.3
181 0.22
182 0.16
183 0.11
184 0.11
185 0.11
186 0.11
187 0.11
188 0.1
189 0.1
190 0.11
191 0.09
192 0.08
193 0.07
194 0.07
195 0.08
196 0.08
197 0.08
198 0.09
199 0.08
200 0.08
201 0.1
202 0.11
203 0.16
204 0.16
205 0.22
206 0.22
207 0.26
208 0.26
209 0.24
210 0.23
211 0.18
212 0.17
213 0.12
214 0.11
215 0.08
216 0.09
217 0.1
218 0.1
219 0.1
220 0.1
221 0.11
222 0.11
223 0.11
224 0.11
225 0.1
226 0.13
227 0.12
228 0.12
229 0.16
230 0.18
231 0.18
232 0.21
233 0.24
234 0.22
235 0.25
236 0.27
237 0.23
238 0.21
239 0.2
240 0.19
241 0.18
242 0.2
243 0.22
244 0.22
245 0.25
246 0.29
247 0.31
248 0.34
249 0.36
250 0.33
251 0.3
252 0.36
253 0.34
254 0.29
255 0.3
256 0.27
257 0.29
258 0.28
259 0.28
260 0.24
261 0.24
262 0.26
263 0.27
264 0.3
265 0.27
266 0.28
267 0.29
268 0.28
269 0.3
270 0.3
271 0.26
272 0.25
273 0.23
274 0.24
275 0.23
276 0.24
277 0.25
278 0.24
279 0.24
280 0.21
281 0.2
282 0.21
283 0.19
284 0.18
285 0.12
286 0.16
287 0.2
288 0.24
289 0.26
290 0.26
291 0.28
292 0.27
293 0.28
294 0.28
295 0.33
296 0.36
297 0.44
298 0.42
299 0.47
300 0.52
301 0.5
302 0.48
303 0.41
304 0.38
305 0.3
306 0.3
307 0.24
308 0.19
309 0.19
310 0.19
311 0.18
312 0.16
313 0.15
314 0.15
315 0.18
316 0.16
317 0.2
318 0.22
319 0.27
320 0.28
321 0.28
322 0.3
323 0.28
324 0.31
325 0.26
326 0.28
327 0.24
328 0.26
329 0.27
330 0.25
331 0.24
332 0.21
333 0.21
334 0.19
335 0.21
336 0.17
337 0.14
338 0.14
339 0.13
340 0.15
341 0.19
342 0.18
343 0.15
344 0.15
345 0.19
346 0.2
347 0.21
348 0.22
349 0.24
350 0.24
351 0.25
352 0.26
353 0.23
354 0.26
355 0.26
356 0.24
357 0.18
358 0.18
359 0.16
360 0.18
361 0.16
362 0.12
363 0.13
364 0.13
365 0.14
366 0.18
367 0.18
368 0.16
369 0.16
370 0.19
371 0.19
372 0.2
373 0.2
374 0.19
375 0.2
376 0.25
377 0.27
378 0.25
379 0.25
380 0.25
381 0.27
382 0.29
383 0.33
384 0.29
385 0.33
386 0.36
387 0.4
388 0.41
389 0.4
390 0.42
391 0.4
392 0.37
393 0.34
394 0.33
395 0.28
396 0.27
397 0.25
398 0.21
399 0.22
400 0.23
401 0.24
402 0.22
403 0.24
404 0.26
405 0.25
406 0.22
407 0.19
408 0.2
409 0.17
410 0.17
411 0.15
412 0.12
413 0.11
414 0.1
415 0.12
416 0.1
417 0.1
418 0.09
419 0.09
420 0.09
421 0.09
422 0.09
423 0.08
424 0.12
425 0.13
426 0.14
427 0.17
428 0.19
429 0.21
430 0.21
431 0.24
432 0.24
433 0.29
434 0.33
435 0.39
436 0.41
437 0.42
438 0.43
439 0.4
440 0.36
441 0.29
442 0.23
443 0.17
444 0.15
445 0.14
446 0.12
447 0.15
448 0.15
449 0.15
450 0.16
451 0.14
452 0.12
453 0.14
454 0.2
455 0.16
456 0.17
457 0.17
458 0.16
459 0.19
460 0.19
461 0.18
462 0.12
463 0.15
464 0.2
465 0.22
466 0.23
467 0.23
468 0.25
469 0.25
470 0.27
471 0.3
472 0.34
473 0.4
474 0.41
475 0.4
476 0.44
477 0.46
478 0.47
479 0.44
480 0.45
481 0.46
482 0.49
483 0.56
484 0.5
485 0.5
486 0.53
487 0.52
488 0.49
489 0.48
490 0.44
491 0.4
492 0.48
493 0.47
494 0.45
495 0.46
496 0.45
497 0.38
498 0.41
499 0.39
500 0.31
501 0.31
502 0.31
503 0.31
504 0.32
505 0.34
506 0.29
507 0.31
508 0.32
509 0.31
510 0.3
511 0.32
512 0.27
513 0.25
514 0.24
515 0.2
516 0.19
517 0.19
518 0.23
519 0.17
520 0.2
521 0.2
522 0.23
523 0.29
524 0.28
525 0.34
526 0.31
527 0.35
528 0.35
529 0.35
530 0.37
531 0.39
532 0.42
533 0.39
534 0.36
535 0.32
536 0.31
537 0.3
538 0.26
539 0.26
540 0.27
541 0.25