Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HAY9

Protein Details
Accession A0A2V5HAY9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-45FLPSTKSEKEKEKRKKKIRNKKKEKKKTRALTDRMABasic
NLS Segment(s)
PositionSequence
17-38EKEKEKRKKKIRNKKKEKKKTR
Subcellular Location(s) nucl 17, cyto_nucl 12, mito 5, cyto 5
Family & Domain DBs
Amino Acid Sequences MAIPETCRYFLPSTKSEKEKEKRKKKIRNKKKEKKKTRALTDRMAQKLAAEVFSELEITPLLSLFLEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.5
4 0.57
5 0.62
6 0.66
7 0.72
8 0.74
9 0.78
10 0.84
11 0.91
12 0.91
13 0.94
14 0.94
15 0.95
16 0.95
17 0.95
18 0.96
19 0.96
20 0.96
21 0.94
22 0.94
23 0.92
24 0.91
25 0.9
26 0.84
27 0.8
28 0.75
29 0.73
30 0.64
31 0.55
32 0.44
33 0.34
34 0.32
35 0.26
36 0.2
37 0.13
38 0.11
39 0.11
40 0.11
41 0.12
42 0.08
43 0.08
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06