Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5GSK8

Protein Details
Accession A0A2V5GSK8    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-94RSPASLSRSPRHRRSRTRTRSPSRTRSRSPYRDHRGYKRRRDDDYBasic
152-175SDESDRRREKRARTRSRSPFREVRBasic
NLS Segment(s)
PositionSequence
42-90PRASSPAPRSPASLSRSPRHRRSRTRTRSPSRTRSRSPYRDHRGYKRRR
157-178RRREKRARTRSRSPFREVRKPK
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MASRRSRSPSTPSEGEIIESGSETKATTSQLPLNGNRVDRPPRASSPAPRSPASLSRSPRHRRSRTRTRSPSRTRSRSPYRDHRGYKRRRDDDYDRDYDYDDRRSRYEPSHRVDSRYDDSRYAGRGGQSHRRPRPYYDYDREENFGEGLRYSDESDRRREKRARTRSRSPFREVRKPKQYSGDEWKTQRGDSVASRDRRRKASIEQSVSERGKAPVVARDLQSHAETQKPQVQQASGTPSVRLERYAHMTGSRRAGTYSQTLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.32
4 0.25
5 0.17
6 0.14
7 0.13
8 0.1
9 0.1
10 0.09
11 0.09
12 0.1
13 0.12
14 0.14
15 0.17
16 0.21
17 0.26
18 0.3
19 0.31
20 0.35
21 0.37
22 0.37
23 0.36
24 0.38
25 0.41
26 0.4
27 0.43
28 0.43
29 0.44
30 0.49
31 0.52
32 0.54
33 0.56
34 0.61
35 0.59
36 0.54
37 0.52
38 0.49
39 0.51
40 0.47
41 0.46
42 0.44
43 0.47
44 0.56
45 0.62
46 0.68
47 0.72
48 0.76
49 0.8
50 0.84
51 0.88
52 0.88
53 0.91
54 0.92
55 0.91
56 0.92
57 0.91
58 0.91
59 0.91
60 0.88
61 0.84
62 0.83
63 0.83
64 0.81
65 0.8
66 0.8
67 0.79
68 0.8
69 0.81
70 0.82
71 0.82
72 0.83
73 0.85
74 0.85
75 0.82
76 0.77
77 0.78
78 0.76
79 0.75
80 0.73
81 0.66
82 0.57
83 0.51
84 0.47
85 0.42
86 0.36
87 0.35
88 0.3
89 0.28
90 0.29
91 0.3
92 0.32
93 0.35
94 0.42
95 0.41
96 0.44
97 0.52
98 0.51
99 0.52
100 0.51
101 0.49
102 0.44
103 0.41
104 0.37
105 0.28
106 0.28
107 0.27
108 0.26
109 0.22
110 0.19
111 0.15
112 0.17
113 0.2
114 0.28
115 0.34
116 0.42
117 0.46
118 0.52
119 0.52
120 0.53
121 0.58
122 0.56
123 0.58
124 0.56
125 0.56
126 0.52
127 0.52
128 0.49
129 0.41
130 0.33
131 0.24
132 0.17
133 0.12
134 0.09
135 0.08
136 0.07
137 0.07
138 0.09
139 0.12
140 0.18
141 0.2
142 0.27
143 0.36
144 0.38
145 0.45
146 0.5
147 0.57
148 0.62
149 0.71
150 0.74
151 0.74
152 0.82
153 0.85
154 0.89
155 0.85
156 0.81
157 0.78
158 0.74
159 0.77
160 0.75
161 0.74
162 0.74
163 0.73
164 0.69
165 0.71
166 0.66
167 0.62
168 0.64
169 0.62
170 0.58
171 0.56
172 0.58
173 0.5
174 0.47
175 0.41
176 0.32
177 0.27
178 0.23
179 0.3
180 0.32
181 0.38
182 0.45
183 0.51
184 0.56
185 0.59
186 0.6
187 0.56
188 0.57
189 0.61
190 0.63
191 0.61
192 0.58
193 0.57
194 0.6
195 0.56
196 0.48
197 0.39
198 0.31
199 0.26
200 0.26
201 0.23
202 0.21
203 0.24
204 0.27
205 0.26
206 0.29
207 0.29
208 0.3
209 0.29
210 0.26
211 0.23
212 0.26
213 0.26
214 0.27
215 0.32
216 0.31
217 0.33
218 0.35
219 0.34
220 0.3
221 0.33
222 0.36
223 0.34
224 0.33
225 0.3
226 0.29
227 0.32
228 0.31
229 0.29
230 0.24
231 0.24
232 0.31
233 0.33
234 0.32
235 0.34
236 0.38
237 0.4
238 0.45
239 0.42
240 0.36
241 0.35
242 0.35
243 0.33
244 0.34