Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V5HBZ7

Protein Details
Accession A0A2V5HBZ7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
58-77KTPSCPKPSLLRLRMKQRGQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 10, cyto 7, mito 3.5, cyto_pero 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
IPR027179  MTCP1  
Pfam View protein in Pfam  
PF08991  MTCP1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MGGLKEDLAYDPPCHPRACAIQACLTKNSYQEEKCQSQINALYECCNSFYKEQGEEAKTPSCPKPSLLRLRMKQRGQES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.27
4 0.31
5 0.36
6 0.35
7 0.32
8 0.36
9 0.4
10 0.42
11 0.4
12 0.35
13 0.29
14 0.28
15 0.29
16 0.28
17 0.25
18 0.28
19 0.33
20 0.34
21 0.34
22 0.36
23 0.31
24 0.29
25 0.31
26 0.27
27 0.22
28 0.2
29 0.2
30 0.16
31 0.16
32 0.16
33 0.14
34 0.13
35 0.12
36 0.16
37 0.17
38 0.18
39 0.21
40 0.24
41 0.27
42 0.26
43 0.29
44 0.28
45 0.26
46 0.29
47 0.3
48 0.29
49 0.27
50 0.29
51 0.35
52 0.42
53 0.51
54 0.56
55 0.62
56 0.66
57 0.76
58 0.82
59 0.79