Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NJ38

Protein Details
Accession B8NJ38   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
46-75QLRSRLKKWRVTKPSRQTRKKSQDNQQDVNHydrophilic
NLS Segment(s)
PositionSequence
52-64KKWRVTKPSRQTR
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR025676  Clr5_dom  
Pfam View protein in Pfam  
PF14420  Clr5  
Amino Acid Sequences MKNTIPSDVWERKKALIAKLYKDEEWPLKQVIKQIRSDDFNPSETQLRSRLKKWRVTKPSRQTRKKSQDNQQDVNGDSSSHEAGSPKDEIPISPKTQLYSTQKEATGFFRASYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.48
3 0.47
4 0.47
5 0.48
6 0.53
7 0.55
8 0.48
9 0.45
10 0.44
11 0.42
12 0.39
13 0.36
14 0.31
15 0.3
16 0.31
17 0.36
18 0.39
19 0.37
20 0.38
21 0.39
22 0.41
23 0.42
24 0.42
25 0.42
26 0.36
27 0.33
28 0.3
29 0.27
30 0.27
31 0.24
32 0.24
33 0.24
34 0.28
35 0.3
36 0.34
37 0.41
38 0.43
39 0.52
40 0.57
41 0.61
42 0.65
43 0.7
44 0.76
45 0.77
46 0.82
47 0.84
48 0.86
49 0.83
50 0.84
51 0.86
52 0.86
53 0.84
54 0.83
55 0.83
56 0.82
57 0.77
58 0.7
59 0.62
60 0.53
61 0.46
62 0.36
63 0.26
64 0.18
65 0.17
66 0.13
67 0.1
68 0.1
69 0.09
70 0.09
71 0.12
72 0.14
73 0.12
74 0.15
75 0.15
76 0.15
77 0.18
78 0.24
79 0.24
80 0.26
81 0.27
82 0.26
83 0.28
84 0.36
85 0.39
86 0.41
87 0.44
88 0.44
89 0.45
90 0.45
91 0.45
92 0.41
93 0.38
94 0.31