Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5I2C4

Protein Details
Accession A0A2V5I2C4   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-34CLVGRCGSCRRKKCSPRFVLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR006058  2Fe2S_fd_BS  
Gene Ontology GO:0051537  F:2 iron, 2 sulfur cluster binding  
PROSITE View protein in PROSITE  
PS00197  2FE2S_FER_1  
Amino Acid Sequences MNFQARSLSVRVYVCLVGRCGSCRRKKCSPRFVLMSCECQFNVNSMSIQCQFNVNSMSIQCQFNANPNVKFSLSASQAISERPVLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.2
4 0.18
5 0.18
6 0.2
7 0.26
8 0.34
9 0.41
10 0.47
11 0.53
12 0.62
13 0.72
14 0.79
15 0.82
16 0.8
17 0.78
18 0.77
19 0.71
20 0.69
21 0.6
22 0.57
23 0.46
24 0.41
25 0.33
26 0.27
27 0.25
28 0.19
29 0.18
30 0.11
31 0.11
32 0.09
33 0.12
34 0.13
35 0.14
36 0.12
37 0.13
38 0.12
39 0.14
40 0.15
41 0.13
42 0.12
43 0.12
44 0.14
45 0.15
46 0.15
47 0.13
48 0.14
49 0.14
50 0.2
51 0.27
52 0.29
53 0.28
54 0.29
55 0.32
56 0.3
57 0.3
58 0.25
59 0.26
60 0.24
61 0.25
62 0.24
63 0.24
64 0.24
65 0.24
66 0.25