Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NSC2

Protein Details
Accession B8NSC2   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
42-68RTETAVRRMRRKAKAKRKSRTRMIGMIHydrophilic
NLS Segment(s)
PositionSequence
48-62RRMRRKAKAKRKSRT
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MAGFEASALDNYYLPRAKIQPPSFSPTLSGCGWINGWIGLSRTETAVRRMRRKAKAKRKSRTRMIGMIWQPRAFAATCPAPYSLSTRFSYIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.2
3 0.23
4 0.28
5 0.37
6 0.4
7 0.43
8 0.45
9 0.51
10 0.48
11 0.44
12 0.41
13 0.32
14 0.32
15 0.24
16 0.22
17 0.15
18 0.15
19 0.15
20 0.14
21 0.13
22 0.09
23 0.09
24 0.07
25 0.08
26 0.08
27 0.09
28 0.08
29 0.09
30 0.11
31 0.11
32 0.16
33 0.23
34 0.27
35 0.33
36 0.4
37 0.48
38 0.56
39 0.65
40 0.71
41 0.75
42 0.8
43 0.84
44 0.87
45 0.89
46 0.89
47 0.89
48 0.87
49 0.82
50 0.77
51 0.7
52 0.68
53 0.64
54 0.62
55 0.55
56 0.46
57 0.4
58 0.34
59 0.33
60 0.25
61 0.19
62 0.17
63 0.19
64 0.19
65 0.21
66 0.22
67 0.21
68 0.22
69 0.26
70 0.25
71 0.25
72 0.26