Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5IFD6

Protein Details
Accession A0A2V5IFD6    Localization Confidence High Confidence Score 21.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-40VNTKPSDTTPAKRKPPKLRRKPPAAEESPAHydrophilic
211-238LQPEPQPQPQRQRQRQQRRRPVATPPRDHydrophilic
240-261STASSYRQQRRRGQRNAGNQDLHydrophilic
NLS Segment(s)
PositionSequence
21-57AKRKPPKLRRKPPAAEESPAEKKAAPAEEPSRAEKPS
66-70QKKKK
Subcellular Location(s) nucl 23, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MTDSAKDSLDVNTKPSDTTPAKRKPPKLRRKPPAAEESPAEKKAAPAEEPSRAEKPSPTEEPASDQKKKKPSEESGTEKSAEQPRSGKQPATSEDLPPIEKLSISDESPSTENPEESPPVENSSPAQEPPTEELPSPEEHSSSPEPAANENPPPTEEAPPTEEHPKQPTSPTPSNQPDSPAKPDPMAEDAKSASSMDELSAPSSPQPEPELQPEPQPQPQRQRQRQQRRRPVATPPRDPSTASSYRQQRRRGQRNAGNQDLLPLGSLGDTGNLTQGAGELVQNTAGKAVSSVGNTAGKAVGGVLGGGQQQGQGQGQEKGGKEEQLRLRLDLNLDVEVQLKAKIHGDLTLQLLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.33
4 0.31
5 0.39
6 0.46
7 0.52
8 0.62
9 0.71
10 0.8
11 0.82
12 0.87
13 0.9
14 0.91
15 0.92
16 0.92
17 0.94
18 0.93
19 0.91
20 0.9
21 0.84
22 0.77
23 0.7
24 0.67
25 0.63
26 0.55
27 0.47
28 0.37
29 0.33
30 0.34
31 0.33
32 0.27
33 0.27
34 0.31
35 0.37
36 0.4
37 0.43
38 0.41
39 0.38
40 0.38
41 0.35
42 0.36
43 0.36
44 0.38
45 0.37
46 0.37
47 0.36
48 0.41
49 0.46
50 0.49
51 0.5
52 0.51
53 0.55
54 0.61
55 0.65
56 0.66
57 0.66
58 0.66
59 0.68
60 0.7
61 0.71
62 0.67
63 0.66
64 0.6
65 0.51
66 0.48
67 0.46
68 0.39
69 0.34
70 0.32
71 0.33
72 0.4
73 0.43
74 0.39
75 0.35
76 0.39
77 0.39
78 0.43
79 0.41
80 0.33
81 0.35
82 0.34
83 0.31
84 0.25
85 0.24
86 0.16
87 0.15
88 0.14
89 0.14
90 0.15
91 0.14
92 0.16
93 0.14
94 0.16
95 0.17
96 0.17
97 0.17
98 0.16
99 0.16
100 0.16
101 0.18
102 0.18
103 0.17
104 0.2
105 0.16
106 0.19
107 0.19
108 0.18
109 0.16
110 0.18
111 0.19
112 0.16
113 0.17
114 0.13
115 0.15
116 0.19
117 0.21
118 0.18
119 0.17
120 0.18
121 0.19
122 0.2
123 0.21
124 0.17
125 0.14
126 0.13
127 0.18
128 0.18
129 0.18
130 0.17
131 0.16
132 0.16
133 0.17
134 0.19
135 0.16
136 0.17
137 0.17
138 0.16
139 0.15
140 0.17
141 0.18
142 0.18
143 0.16
144 0.16
145 0.18
146 0.18
147 0.2
148 0.23
149 0.23
150 0.22
151 0.25
152 0.25
153 0.24
154 0.25
155 0.28
156 0.31
157 0.35
158 0.34
159 0.38
160 0.41
161 0.43
162 0.4
163 0.39
164 0.35
165 0.33
166 0.38
167 0.32
168 0.29
169 0.26
170 0.26
171 0.24
172 0.23
173 0.22
174 0.16
175 0.14
176 0.14
177 0.14
178 0.14
179 0.12
180 0.08
181 0.06
182 0.06
183 0.05
184 0.07
185 0.07
186 0.07
187 0.07
188 0.07
189 0.08
190 0.1
191 0.1
192 0.09
193 0.11
194 0.13
195 0.15
196 0.19
197 0.23
198 0.21
199 0.26
200 0.29
201 0.3
202 0.34
203 0.38
204 0.38
205 0.44
206 0.53
207 0.59
208 0.64
209 0.71
210 0.77
211 0.83
212 0.88
213 0.9
214 0.92
215 0.9
216 0.88
217 0.81
218 0.81
219 0.81
220 0.79
221 0.76
222 0.7
223 0.65
224 0.59
225 0.56
226 0.48
227 0.46
228 0.42
229 0.36
230 0.39
231 0.44
232 0.51
233 0.58
234 0.63
235 0.64
236 0.69
237 0.77
238 0.79
239 0.8
240 0.8
241 0.84
242 0.84
243 0.79
244 0.69
245 0.58
246 0.51
247 0.41
248 0.32
249 0.21
250 0.13
251 0.08
252 0.06
253 0.07
254 0.05
255 0.05
256 0.05
257 0.05
258 0.06
259 0.06
260 0.06
261 0.06
262 0.06
263 0.05
264 0.06
265 0.06
266 0.05
267 0.06
268 0.08
269 0.08
270 0.08
271 0.09
272 0.08
273 0.08
274 0.08
275 0.09
276 0.09
277 0.1
278 0.11
279 0.13
280 0.15
281 0.15
282 0.15
283 0.14
284 0.11
285 0.1
286 0.1
287 0.07
288 0.05
289 0.05
290 0.05
291 0.06
292 0.07
293 0.07
294 0.07
295 0.07
296 0.07
297 0.1
298 0.1
299 0.11
300 0.14
301 0.16
302 0.2
303 0.24
304 0.24
305 0.29
306 0.3
307 0.33
308 0.32
309 0.39
310 0.43
311 0.45
312 0.47
313 0.42
314 0.42
315 0.4
316 0.4
317 0.35
318 0.3
319 0.24
320 0.22
321 0.21
322 0.2
323 0.18
324 0.17
325 0.15
326 0.14
327 0.14
328 0.16
329 0.17
330 0.17
331 0.19
332 0.21
333 0.22