Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5H663

Protein Details
Accession A0A2V5H663    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPRGPKKHQKRLSAPSHWLLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, cyto 7, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR032277  40S_S4_C  
IPR041982  KOW_RPS4  
IPR014722  Rib_L2_dom2  
IPR000876  Ribosomal_S4e  
IPR013845  Ribosomal_S4e_central_region  
IPR038237  Ribosomal_S4e_central_sf  
IPR013843  Ribosomal_S4e_N  
IPR018199  Ribosomal_S4e_N_CS  
IPR002942  S4_RNA-bd  
IPR036986  S4_RNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF16121  40S_S4_C  
PF00900  Ribosomal_S4e  
PF08071  RS4NT  
PF01479  S4  
PROSITE View protein in PROSITE  
PS00528  RIBOSOMAL_S4E  
PS50889  S4  
CDD cd06087  KOW_RPS4  
cd00165  S4  
Amino Acid Sequences MPRGPKKHQKRLSAPSHWLLDKMSGTYAPKASPGPHKLRDCLPLIVFIRNRLKYALNGRETKAIMMQRLIKVDGKVRTDPTYPAGFMDVIGIEKTGENFRLIYDTKGRFTVHRIQAEEAEYKLCKVKRVQLGKGGIPFLVTHDARTIRYPDPAIKVNDTVKVDITTGKIADFVRFDTGVVCMVTGGRNMGRVGVVTHRERHDGGFNIVHIKDAIDNTFATRESNVFVIGQDKPWISLPKGKGVKLSIAEERDRRRAYAIAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.77
3 0.74
4 0.64
5 0.55
6 0.46
7 0.4
8 0.33
9 0.27
10 0.23
11 0.19
12 0.21
13 0.24
14 0.25
15 0.21
16 0.22
17 0.23
18 0.25
19 0.32
20 0.38
21 0.43
22 0.5
23 0.53
24 0.54
25 0.57
26 0.58
27 0.53
28 0.48
29 0.41
30 0.39
31 0.37
32 0.4
33 0.36
34 0.38
35 0.43
36 0.4
37 0.4
38 0.35
39 0.35
40 0.34
41 0.43
42 0.45
43 0.43
44 0.45
45 0.45
46 0.48
47 0.47
48 0.42
49 0.37
50 0.31
51 0.25
52 0.25
53 0.29
54 0.26
55 0.27
56 0.28
57 0.26
58 0.25
59 0.29
60 0.31
61 0.3
62 0.31
63 0.32
64 0.33
65 0.32
66 0.32
67 0.3
68 0.27
69 0.23
70 0.2
71 0.19
72 0.15
73 0.14
74 0.13
75 0.09
76 0.07
77 0.07
78 0.06
79 0.05
80 0.06
81 0.07
82 0.07
83 0.08
84 0.08
85 0.08
86 0.08
87 0.12
88 0.12
89 0.13
90 0.19
91 0.2
92 0.21
93 0.23
94 0.24
95 0.21
96 0.25
97 0.33
98 0.32
99 0.34
100 0.35
101 0.34
102 0.35
103 0.36
104 0.32
105 0.23
106 0.18
107 0.14
108 0.13
109 0.16
110 0.15
111 0.16
112 0.17
113 0.24
114 0.31
115 0.37
116 0.39
117 0.41
118 0.44
119 0.42
120 0.42
121 0.35
122 0.26
123 0.2
124 0.18
125 0.12
126 0.14
127 0.12
128 0.11
129 0.13
130 0.15
131 0.15
132 0.17
133 0.19
134 0.15
135 0.17
136 0.18
137 0.19
138 0.22
139 0.25
140 0.26
141 0.24
142 0.25
143 0.25
144 0.28
145 0.26
146 0.23
147 0.19
148 0.18
149 0.17
150 0.15
151 0.15
152 0.12
153 0.11
154 0.1
155 0.12
156 0.11
157 0.12
158 0.12
159 0.11
160 0.13
161 0.12
162 0.13
163 0.1
164 0.11
165 0.1
166 0.09
167 0.08
168 0.06
169 0.06
170 0.07
171 0.06
172 0.08
173 0.07
174 0.08
175 0.08
176 0.09
177 0.09
178 0.08
179 0.1
180 0.13
181 0.19
182 0.2
183 0.25
184 0.27
185 0.29
186 0.3
187 0.31
188 0.31
189 0.28
190 0.29
191 0.26
192 0.25
193 0.27
194 0.26
195 0.24
196 0.18
197 0.16
198 0.15
199 0.15
200 0.15
201 0.12
202 0.12
203 0.13
204 0.15
205 0.14
206 0.13
207 0.13
208 0.12
209 0.13
210 0.13
211 0.12
212 0.11
213 0.11
214 0.13
215 0.14
216 0.14
217 0.16
218 0.16
219 0.17
220 0.22
221 0.25
222 0.25
223 0.32
224 0.33
225 0.4
226 0.45
227 0.45
228 0.45
229 0.44
230 0.47
231 0.43
232 0.45
233 0.42
234 0.42
235 0.47
236 0.49
237 0.53
238 0.56
239 0.54
240 0.5
241 0.47