Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HNM7

Protein Details
Accession A0A2V5HNM7   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
17-45QWAPPRRGAKPVPKRKKARPSRLSQSLPPHydrophilic
NLS Segment(s)
PositionSequence
20-38PPRRGAKPVPKRKKARPSR
Subcellular Location(s) plas 15, mito 3, nucl 2, extr 2, golg 2, vacu 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MDSPIFFTCWHRSEMAQWAPPRRGAKPVPKRKKARPSRLSQSLPPKMPTLVVHLSLSLCLLNPDKPASQPSPAQLPTYLGTFSSFDRQKGEYGADPLVPAFLTLFFCFPLSPLATSPIFFEVHRGGRGGPSAGGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.38
4 0.41
5 0.45
6 0.46
7 0.51
8 0.51
9 0.44
10 0.45
11 0.46
12 0.53
13 0.57
14 0.66
15 0.71
16 0.77
17 0.84
18 0.87
19 0.9
20 0.9
21 0.9
22 0.88
23 0.86
24 0.86
25 0.87
26 0.81
27 0.77
28 0.76
29 0.72
30 0.65
31 0.58
32 0.49
33 0.4
34 0.37
35 0.31
36 0.27
37 0.21
38 0.2
39 0.18
40 0.17
41 0.17
42 0.15
43 0.15
44 0.08
45 0.06
46 0.06
47 0.07
48 0.07
49 0.08
50 0.1
51 0.1
52 0.11
53 0.15
54 0.15
55 0.17
56 0.17
57 0.17
58 0.21
59 0.21
60 0.21
61 0.18
62 0.18
63 0.16
64 0.16
65 0.15
66 0.09
67 0.1
68 0.1
69 0.11
70 0.16
71 0.17
72 0.17
73 0.19
74 0.2
75 0.2
76 0.2
77 0.22
78 0.16
79 0.18
80 0.18
81 0.15
82 0.14
83 0.13
84 0.12
85 0.09
86 0.08
87 0.05
88 0.06
89 0.08
90 0.08
91 0.09
92 0.09
93 0.1
94 0.1
95 0.1
96 0.12
97 0.12
98 0.12
99 0.13
100 0.17
101 0.17
102 0.17
103 0.18
104 0.17
105 0.17
106 0.15
107 0.18
108 0.2
109 0.23
110 0.24
111 0.24
112 0.22
113 0.23
114 0.26
115 0.23