FuNGI

A0A0D1E922

Protein Details

Accession

A0A0D1E922

Localization Confidence

Medium

Confidence Score

10.8

NoLS Segment(s)

Position	Sequence	Protein Nature
534-562	VDVLSVGRKKPPKKTKKAGPDGVRQRGKG	Basic

NLS Segment(s)

Position	Sequence
541-570	RKKPPKKTKKAGPDGVRQRGKGRGRGGSAG

Subcellular Location(s)

nucl 9, extr 8, mito 5, cyto 5, cyto_mito 5

Family & Domain DBs

InterPro	View protein in InterPro IPR036638 HLH_DNA-bd_sf
Gene Ontology	GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0046983 F:protein dimerization activity GO:0000978 F:RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0006357 P:regulation of transcription by RNA polymerase II
KEGG	uma:UMAG_11197 -

Amino Acid Sequences

MSALPTTSSVAVYSLAPSASASTSAEAMLQHPDSMDKSSDLPPMPVPYEDFHFSLDLPAELDLNDLQFLSSVDRKGGPSNPMTPGLTSHFMASTPQALNFGHDDVHMASRSNSRRGSLSKGSRPASPRVGSSRFSESALRPPPPPDFEPSRPNMFDTDAFASGTFSPFGIGTPSAGDKPSHNNPLFDAKEKNLLVNFLEGFEWDFDPSLPEGMPSFSAAAADRSATAAAEAMGFPSDSGSAAASSRDPMLHQGPAMSAAARRLQTRTKAAAGVPSASSGSNSGSVTASSQSPHDTSSSATSPHGSNRSQQHPRSLSNTKSRAFHREADLVNTAFGGALSEWSLGAPASHQPPASQQHAIHDHSATGSKRHAGHFGDGDADEQTQAALALGSLTGMHAEMFRMSAGLDMVAHSNNPTQAPASQPPRPAAKSALIAKSASGKKLKVEHEDEEDRLDRTDSSAPSKRELLTESEKRQNHILSEQRRRNYIREGFKDLVVLLDDGRNFGARALGLSSGFGTGVEDEGLDDRSDIDDVVDVLSVGRKKPPKKTKKAGPDGVRQRGKGRGRGGSAGGGAGSKSAVLFQAVDLIRWLDGKSKELTQQCEALEQVAGIPDPESIVAANRPASAEAAN

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.12
2	0.1
3	0.1
4	0.1
5	0.11
6	0.11
7	0.12
8	0.11
9	0.11
10	0.12
11	0.11
12	0.12
13	0.11
14	0.11
15	0.15
16	0.15
17	0.14
18	0.14
19	0.16
20	0.16
21	0.19
22	0.2
23	0.16
24	0.19
25	0.23
26	0.28
27	0.27
28	0.28
29	0.27
30	0.3
31	0.31
32	0.28
33	0.27
34	0.23
35	0.27
36	0.28
37	0.26
38	0.23
39	0.22
40	0.21
41	0.21
42	0.2
43	0.15
44	0.12
45	0.12
46	0.11
47	0.1
48	0.11
49	0.09
50	0.09
51	0.09
52	0.08
53	0.07
54	0.07
55	0.08
56	0.11
57	0.15
58	0.15
59	0.17
60	0.19
61	0.21
62	0.25
63	0.29
64	0.29
65	0.3
66	0.34
67	0.36
68	0.37
69	0.37
70	0.33
71	0.31
72	0.31
73	0.29
74	0.25
75	0.22
76	0.19
77	0.18
78	0.19
79	0.17
80	0.18
81	0.16
82	0.16
83	0.17
84	0.16
85	0.19
86	0.19
87	0.18
88	0.14
89	0.13
90	0.14
91	0.13
92	0.16
93	0.15
94	0.14
95	0.15
96	0.23
97	0.27
98	0.32
99	0.32
100	0.31
101	0.35
102	0.38
103	0.43
104	0.45
105	0.5
106	0.52
107	0.58
108	0.58
109	0.59
110	0.59
111	0.58
112	0.56
113	0.49
114	0.45
115	0.45
116	0.47
117	0.43
118	0.43
119	0.44
120	0.37
121	0.37
122	0.37
123	0.31
124	0.36
125	0.4
126	0.38
127	0.33
128	0.35
129	0.38
130	0.39
131	0.39
132	0.37
133	0.39
134	0.42
135	0.48
136	0.49
137	0.51
138	0.46
139	0.45
140	0.4
141	0.35
142	0.3
143	0.27
144	0.26
145	0.2
146	0.19
147	0.18
148	0.18
149	0.15
150	0.15
151	0.12
152	0.08
153	0.08
154	0.08
155	0.08
156	0.08
157	0.08
158	0.07
159	0.09
160	0.1
161	0.11
162	0.12
163	0.12
164	0.12
165	0.19
166	0.26
167	0.33
168	0.33
169	0.33
170	0.34
171	0.42
172	0.42
173	0.39
174	0.35
175	0.27
176	0.34
177	0.33
178	0.33
179	0.25
180	0.24
181	0.21
182	0.2
183	0.19
184	0.12
185	0.12
186	0.1
187	0.1
188	0.1
189	0.1
190	0.08
191	0.08
192	0.07
193	0.09
194	0.09
195	0.09
196	0.07
197	0.07
198	0.08
199	0.08
200	0.08
201	0.07
202	0.07
203	0.06
204	0.07
205	0.07
206	0.08
207	0.07
208	0.07
209	0.07
210	0.07
211	0.07
212	0.06
213	0.06
214	0.05
215	0.05
216	0.05
217	0.05
218	0.04
219	0.04
220	0.04
221	0.04
222	0.04
223	0.04
224	0.04
225	0.05
226	0.05
227	0.05
228	0.05
229	0.06
230	0.06
231	0.07
232	0.07
233	0.07
234	0.07
235	0.1
236	0.12
237	0.12
238	0.11
239	0.11
240	0.11
241	0.12
242	0.12
243	0.09
244	0.07
245	0.08
246	0.12
247	0.12
248	0.13
249	0.15
250	0.19
251	0.23
252	0.27
253	0.28
254	0.26
255	0.27
256	0.26
257	0.27
258	0.24
259	0.21
260	0.16
261	0.14
262	0.13
263	0.11
264	0.11
265	0.08
266	0.08
267	0.08
268	0.08
269	0.08
270	0.08
271	0.08
272	0.09
273	0.09
274	0.09
275	0.07
276	0.08
277	0.08
278	0.09
279	0.1
280	0.09
281	0.09
282	0.09
283	0.12
284	0.12
285	0.12
286	0.12
287	0.12
288	0.12
289	0.15
290	0.18
291	0.16
292	0.2
293	0.25
294	0.34
295	0.39
296	0.4
297	0.45
298	0.45
299	0.46
300	0.48
301	0.47
302	0.44
303	0.45
304	0.49
305	0.43
306	0.44
307	0.44
308	0.44
309	0.43
310	0.41
311	0.36
312	0.36
313	0.34
314	0.33
315	0.32
316	0.26
317	0.22
318	0.18
319	0.14
320	0.09
321	0.08
322	0.05
323	0.03
324	0.03
325	0.04
326	0.04
327	0.04
328	0.04
329	0.04
330	0.04
331	0.04
332	0.04
333	0.06
334	0.08
335	0.1
336	0.1
337	0.1
338	0.15
339	0.19
340	0.21
341	0.22
342	0.2
343	0.24
344	0.29
345	0.3
346	0.27
347	0.23
348	0.2
349	0.18
350	0.22
351	0.17
352	0.14
353	0.14
354	0.16
355	0.18
356	0.19
357	0.23
358	0.2
359	0.22
360	0.21
361	0.21
362	0.19
363	0.17
364	0.16
365	0.12
366	0.11
367	0.08
368	0.07
369	0.06
370	0.04
371	0.04
372	0.03
373	0.03
374	0.02
375	0.03
376	0.03
377	0.03
378	0.03
379	0.03
380	0.03
381	0.03
382	0.03
383	0.03
384	0.04
385	0.04
386	0.04
387	0.04
388	0.04
389	0.04
390	0.05
391	0.04
392	0.04
393	0.04
394	0.04
395	0.06
396	0.06
397	0.06
398	0.06
399	0.07
400	0.09
401	0.09
402	0.09
403	0.09
404	0.1
405	0.15
406	0.21
407	0.25
408	0.28
409	0.31
410	0.33
411	0.38
412	0.39
413	0.36
414	0.32
415	0.3
416	0.31
417	0.34
418	0.34
419	0.3
420	0.29
421	0.27
422	0.32
423	0.31
424	0.3
425	0.27
426	0.25
427	0.28
428	0.35
429	0.39
430	0.38
431	0.41
432	0.4
433	0.44
434	0.47
435	0.43
436	0.4
437	0.37
438	0.3
439	0.25
440	0.23
441	0.15
442	0.15
443	0.19
444	0.17
445	0.24
446	0.3
447	0.31
448	0.33
449	0.36
450	0.34
451	0.31
452	0.31
453	0.3
454	0.32
455	0.39
456	0.42
457	0.48
458	0.48
459	0.48
460	0.5
461	0.46
462	0.39
463	0.39
464	0.42
465	0.43
466	0.53
467	0.58
468	0.57
469	0.62
470	0.63
471	0.59
472	0.6
473	0.59
474	0.58
475	0.56
476	0.61
477	0.56
478	0.53
479	0.5
480	0.4
481	0.32
482	0.23
483	0.18
484	0.1
485	0.11
486	0.11
487	0.11
488	0.11
489	0.11
490	0.1
491	0.1
492	0.1
493	0.08
494	0.09
495	0.09
496	0.1
497	0.09
498	0.1
499	0.1
500	0.08
501	0.08
502	0.07
503	0.07
504	0.06
505	0.06
506	0.06
507	0.05
508	0.06
509	0.07
510	0.08
511	0.07
512	0.07
513	0.07
514	0.08
515	0.09
516	0.08
517	0.07
518	0.07
519	0.07
520	0.08
521	0.07
522	0.06
523	0.06
524	0.1
525	0.12
526	0.12
527	0.19
528	0.27
529	0.34
530	0.45
531	0.56
532	0.63
533	0.72
534	0.82
535	0.85
536	0.89
537	0.93
538	0.92
539	0.89
540	0.88
541	0.87
542	0.87
543	0.82
544	0.73
545	0.67
546	0.66
547	0.65
548	0.62
549	0.59
550	0.55
551	0.54
552	0.55
553	0.53
554	0.46
555	0.4
556	0.32
557	0.25
558	0.18
559	0.14
560	0.11
561	0.08
562	0.06
563	0.05
564	0.06
565	0.06
566	0.07
567	0.07
568	0.07
569	0.15
570	0.15
571	0.16
572	0.16
573	0.16
574	0.16
575	0.16
576	0.17
577	0.16
578	0.18
579	0.21
580	0.24
581	0.27
582	0.34
583	0.39
584	0.44
585	0.4
586	0.43
587	0.4
588	0.4
589	0.36
590	0.3
591	0.24
592	0.18
593	0.16
594	0.12
595	0.12
596	0.09
597	0.09
598	0.08
599	0.08
600	0.08
601	0.08
602	0.07
603	0.1
604	0.11
605	0.14
606	0.15
607	0.15
608	0.17
609	0.17

A0A0D1E922

3D AlphaFold-predicted Structure Viewer