Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HQ87

Protein Details
Accession A0A2V5HQ87    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-27GGGAIQKIKTKKKKVSLCLHPPSLFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, extr 6, E.R. 5, mito_nucl 5
Family & Domain DBs
Amino Acid Sequences MKGGGAIQKIKTKKKKVSLCLHPPSLFLLLSSVSLILPSLVFQSPPVPGAGPEREPLNNGRIARSKLVSLHFEREHETTRKIFGKKNEKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.82
4 0.85
5 0.85
6 0.86
7 0.83
8 0.8
9 0.7
10 0.61
11 0.54
12 0.45
13 0.34
14 0.24
15 0.17
16 0.11
17 0.1
18 0.1
19 0.07
20 0.05
21 0.05
22 0.05
23 0.04
24 0.04
25 0.04
26 0.05
27 0.05
28 0.05
29 0.06
30 0.07
31 0.07
32 0.08
33 0.08
34 0.06
35 0.06
36 0.1
37 0.12
38 0.12
39 0.13
40 0.14
41 0.14
42 0.16
43 0.17
44 0.16
45 0.19
46 0.18
47 0.21
48 0.24
49 0.27
50 0.28
51 0.27
52 0.26
53 0.26
54 0.29
55 0.31
56 0.29
57 0.34
58 0.33
59 0.33
60 0.35
61 0.34
62 0.37
63 0.35
64 0.35
65 0.3
66 0.35
67 0.41
68 0.42
69 0.45
70 0.49
71 0.56