Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HC82

Protein Details
Accession A0A2V5HC82   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-41PFAFWSWLPKKNRKKEKQTEQHPKSQSHydrophilic
NLS Segment(s)
PositionSequence
25-29KNRKK
Subcellular Location(s) plas 12, E.R. 6, mito 3, pero 3, golg 2, cyto_mito 2, cyto_pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MLLICYLSIATVCIPFAFWSWLPKKNRKKEKQTEQHPKSQSEEPKTPVAFSLILWLMMSVLLHLSSPDPGKYSILSGPPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.09
4 0.12
5 0.12
6 0.2
7 0.24
8 0.31
9 0.38
10 0.48
11 0.57
12 0.63
13 0.74
14 0.76
15 0.83
16 0.86
17 0.9
18 0.91
19 0.91
20 0.92
21 0.86
22 0.84
23 0.77
24 0.68
25 0.61
26 0.56
27 0.52
28 0.46
29 0.45
30 0.4
31 0.41
32 0.39
33 0.35
34 0.29
35 0.25
36 0.19
37 0.15
38 0.16
39 0.11
40 0.11
41 0.11
42 0.1
43 0.08
44 0.08
45 0.08
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.05
52 0.08
53 0.1
54 0.11
55 0.12
56 0.14
57 0.15
58 0.16
59 0.18
60 0.2