Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HGZ2

Protein Details
Accession A0A2V5HGZ2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-31VWFMGQFSKKKCWKRRPDHPPCESLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 11, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MRPLSVWFMGQFSKKKCWKRRPDHPPCESLSVQLRRAADGPPTVLSNSDIMAMAVLPIVTAIIGYELFQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.56
3 0.64
4 0.72
5 0.77
6 0.81
7 0.88
8 0.89
9 0.93
10 0.93
11 0.87
12 0.8
13 0.72
14 0.67
15 0.56
16 0.48
17 0.45
18 0.38
19 0.34
20 0.33
21 0.3
22 0.25
23 0.25
24 0.23
25 0.17
26 0.14
27 0.14
28 0.11
29 0.12
30 0.12
31 0.11
32 0.11
33 0.1
34 0.09
35 0.09
36 0.08
37 0.07
38 0.07
39 0.06
40 0.05
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04