Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5I8L4

Protein Details
Accession A0A2V5I8L4    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
235-301ERVSLSSKKPGKKRRIQLRKRRSAKDEAKKRQEEEEQRKAEKRNRKNREQKLKRRQKAREQKAAAAABasic
NLS Segment(s)
PositionSequence
241-296SKKPGKKRRIQLRKRRSAKDEAKKRQEEEEQRKAEKRNRKNREQKLKRRQKAREQK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018555  DUF2011  
Pfam View protein in Pfam  
PF09428  DUF2011  
Amino Acid Sequences MFDLPMAKRVRRDELLSRDSESPPASPPPESALPDVQQRLGELLNLDALIAPAYAAPEATQPQDNEHKAEDEEQEFEFRLFSAPAPATTTKPLAGATSDDKDANESKGTDPAPAAGVAQKLRIRVRSPTPGAGGLEDGRLVNPFRGYGHYFTAPGSMTGAKADSSEEEMLRAKRQQFEEVAVSGLQMLGFAQVPWPGCYLPWKVVHLKSEKKAKGAKSAGDIDTQPTICVVEPPERVSLSSKKPGKKRRIQLRKRRSAKDEAKKRQEEEEQRKAEKRNRKNREQKLKRRQKAREQKAAAAAAAAAAGTAEGQGAQAARMDEGASSDGGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.61
3 0.57
4 0.56
5 0.52
6 0.48
7 0.46
8 0.38
9 0.3
10 0.27
11 0.31
12 0.29
13 0.26
14 0.26
15 0.29
16 0.32
17 0.33
18 0.34
19 0.32
20 0.32
21 0.37
22 0.38
23 0.33
24 0.29
25 0.26
26 0.24
27 0.2
28 0.18
29 0.13
30 0.11
31 0.11
32 0.1
33 0.09
34 0.07
35 0.07
36 0.06
37 0.05
38 0.05
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.07
45 0.09
46 0.12
47 0.15
48 0.15
49 0.2
50 0.29
51 0.3
52 0.3
53 0.3
54 0.29
55 0.27
56 0.29
57 0.28
58 0.21
59 0.22
60 0.2
61 0.2
62 0.18
63 0.17
64 0.14
65 0.11
66 0.1
67 0.09
68 0.09
69 0.12
70 0.12
71 0.13
72 0.17
73 0.18
74 0.19
75 0.21
76 0.22
77 0.18
78 0.18
79 0.18
80 0.14
81 0.13
82 0.14
83 0.15
84 0.16
85 0.17
86 0.16
87 0.16
88 0.18
89 0.19
90 0.18
91 0.16
92 0.15
93 0.14
94 0.19
95 0.19
96 0.17
97 0.16
98 0.15
99 0.14
100 0.13
101 0.12
102 0.09
103 0.11
104 0.1
105 0.15
106 0.15
107 0.18
108 0.21
109 0.24
110 0.24
111 0.27
112 0.33
113 0.37
114 0.39
115 0.37
116 0.36
117 0.34
118 0.32
119 0.27
120 0.23
121 0.15
122 0.12
123 0.1
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.11
133 0.13
134 0.14
135 0.16
136 0.16
137 0.16
138 0.16
139 0.17
140 0.14
141 0.11
142 0.11
143 0.08
144 0.07
145 0.07
146 0.07
147 0.06
148 0.06
149 0.06
150 0.05
151 0.08
152 0.09
153 0.08
154 0.09
155 0.11
156 0.12
157 0.13
158 0.17
159 0.16
160 0.2
161 0.22
162 0.24
163 0.22
164 0.24
165 0.24
166 0.21
167 0.19
168 0.14
169 0.13
170 0.1
171 0.09
172 0.06
173 0.04
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.06
180 0.07
181 0.08
182 0.09
183 0.08
184 0.08
185 0.13
186 0.14
187 0.17
188 0.19
189 0.22
190 0.26
191 0.28
192 0.34
193 0.37
194 0.41
195 0.43
196 0.51
197 0.49
198 0.5
199 0.53
200 0.5
201 0.53
202 0.5
203 0.46
204 0.4
205 0.44
206 0.39
207 0.35
208 0.33
209 0.25
210 0.24
211 0.22
212 0.17
213 0.12
214 0.12
215 0.1
216 0.11
217 0.11
218 0.15
219 0.16
220 0.18
221 0.2
222 0.2
223 0.21
224 0.24
225 0.29
226 0.29
227 0.37
228 0.42
229 0.47
230 0.56
231 0.65
232 0.71
233 0.75
234 0.79
235 0.81
236 0.86
237 0.9
238 0.91
239 0.93
240 0.93
241 0.92
242 0.9
243 0.85
244 0.85
245 0.85
246 0.84
247 0.84
248 0.84
249 0.85
250 0.82
251 0.78
252 0.74
253 0.73
254 0.73
255 0.72
256 0.72
257 0.68
258 0.68
259 0.71
260 0.72
261 0.71
262 0.71
263 0.72
264 0.73
265 0.76
266 0.81
267 0.86
268 0.89
269 0.92
270 0.93
271 0.93
272 0.94
273 0.96
274 0.93
275 0.93
276 0.92
277 0.92
278 0.92
279 0.91
280 0.9
281 0.84
282 0.82
283 0.78
284 0.7
285 0.58
286 0.47
287 0.36
288 0.25
289 0.2
290 0.13
291 0.06
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.03
298 0.03
299 0.05
300 0.05
301 0.06
302 0.08
303 0.09
304 0.09
305 0.09
306 0.1
307 0.09
308 0.1
309 0.11
310 0.09