Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8NHE5

Protein Details
Accession B8NHE5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-42SITPYTRKLARKSHCKSRLGCQNCKRRRVKHLIGCSSRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGPSITPYTRKLARKSHCKSRLGCQNCKRRRVKHLIGCSSRAQQELCRLGFTHHYVLRLLLAFAGFHIVQTLGDLSNSPYLGMSTDFYTEAEHHLNLAVREVSTLVTQIQPNNSASLYVSTIFIFLSSLVKGPQTGEYMAFRDDGNPGHLSLFLGVPSILELCQTDIHPSVFAIHGGEEEQQHPSPETPLNTNTQHNPETPTHYEDHLAAFRELLSTLIPTSDPRASSYQQSLNQLHFSLHAVLGPLGLGCRFSRWSLLGCIDFRMRLSMICNEESHLLLSSLPSLPCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.8
4 0.81
5 0.81
6 0.77
7 0.77
8 0.78
9 0.75
10 0.77
11 0.75
12 0.77
13 0.78
14 0.85
15 0.84
16 0.82
17 0.85
18 0.85
19 0.86
20 0.85
21 0.87
22 0.87
23 0.82
24 0.78
25 0.72
26 0.67
27 0.59
28 0.51
29 0.41
30 0.34
31 0.38
32 0.41
33 0.37
34 0.33
35 0.3
36 0.3
37 0.34
38 0.34
39 0.33
40 0.28
41 0.28
42 0.27
43 0.27
44 0.27
45 0.22
46 0.18
47 0.11
48 0.1
49 0.08
50 0.08
51 0.1
52 0.08
53 0.07
54 0.08
55 0.07
56 0.07
57 0.08
58 0.09
59 0.06
60 0.06
61 0.07
62 0.08
63 0.1
64 0.1
65 0.09
66 0.08
67 0.08
68 0.09
69 0.09
70 0.09
71 0.08
72 0.09
73 0.09
74 0.09
75 0.1
76 0.1
77 0.12
78 0.13
79 0.12
80 0.11
81 0.12
82 0.13
83 0.12
84 0.13
85 0.11
86 0.09
87 0.09
88 0.09
89 0.08
90 0.07
91 0.08
92 0.07
93 0.09
94 0.1
95 0.11
96 0.12
97 0.14
98 0.14
99 0.15
100 0.14
101 0.12
102 0.11
103 0.11
104 0.1
105 0.09
106 0.09
107 0.08
108 0.08
109 0.07
110 0.07
111 0.06
112 0.05
113 0.06
114 0.05
115 0.06
116 0.06
117 0.06
118 0.06
119 0.07
120 0.09
121 0.09
122 0.09
123 0.1
124 0.11
125 0.12
126 0.12
127 0.12
128 0.1
129 0.09
130 0.1
131 0.09
132 0.1
133 0.1
134 0.09
135 0.09
136 0.09
137 0.09
138 0.08
139 0.08
140 0.05
141 0.05
142 0.05
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.04
149 0.05
150 0.06
151 0.06
152 0.08
153 0.09
154 0.09
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.07
161 0.06
162 0.06
163 0.06
164 0.08
165 0.08
166 0.08
167 0.11
168 0.11
169 0.12
170 0.12
171 0.12
172 0.14
173 0.15
174 0.16
175 0.16
176 0.18
177 0.22
178 0.24
179 0.26
180 0.27
181 0.29
182 0.29
183 0.28
184 0.3
185 0.28
186 0.32
187 0.32
188 0.32
189 0.29
190 0.28
191 0.28
192 0.23
193 0.25
194 0.2
195 0.2
196 0.16
197 0.15
198 0.14
199 0.13
200 0.13
201 0.1
202 0.08
203 0.06
204 0.06
205 0.07
206 0.07
207 0.07
208 0.11
209 0.14
210 0.14
211 0.16
212 0.21
213 0.22
214 0.26
215 0.31
216 0.34
217 0.35
218 0.42
219 0.41
220 0.39
221 0.39
222 0.35
223 0.3
224 0.24
225 0.23
226 0.17
227 0.15
228 0.13
229 0.12
230 0.12
231 0.11
232 0.1
233 0.08
234 0.06
235 0.06
236 0.08
237 0.07
238 0.1
239 0.12
240 0.13
241 0.17
242 0.18
243 0.21
244 0.24
245 0.28
246 0.29
247 0.28
248 0.31
249 0.29
250 0.28
251 0.25
252 0.24
253 0.2
254 0.18
255 0.21
256 0.24
257 0.26
258 0.28
259 0.28
260 0.26
261 0.27
262 0.27
263 0.24
264 0.19
265 0.15
266 0.13
267 0.13
268 0.14
269 0.16