Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HHD5

Protein Details
Accession A0A2V5HHD5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
99-120SRSRGTWRDRRVQIRRHHLRLDBasic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MDLLQLACIFIIDLCALYHRYTDGHWSKSALSCVAFTHVGQDDSRLEGGAMPTTPRSGPRAIATPCSVNQRTALTSQEVVPTAKVAAKGHLHCEPTPGSRSRGTWRDRRVQIRRHHLRLDLGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.08
3 0.09
4 0.1
5 0.1
6 0.1
7 0.11
8 0.11
9 0.21
10 0.25
11 0.27
12 0.27
13 0.28
14 0.3
15 0.32
16 0.33
17 0.25
18 0.2
19 0.17
20 0.16
21 0.18
22 0.16
23 0.13
24 0.15
25 0.15
26 0.15
27 0.14
28 0.16
29 0.13
30 0.14
31 0.14
32 0.1
33 0.09
34 0.08
35 0.09
36 0.08
37 0.07
38 0.07
39 0.07
40 0.08
41 0.08
42 0.09
43 0.11
44 0.11
45 0.12
46 0.13
47 0.19
48 0.19
49 0.21
50 0.21
51 0.2
52 0.21
53 0.26
54 0.26
55 0.2
56 0.2
57 0.2
58 0.2
59 0.19
60 0.19
61 0.14
62 0.14
63 0.14
64 0.15
65 0.14
66 0.13
67 0.12
68 0.11
69 0.1
70 0.11
71 0.12
72 0.11
73 0.14
74 0.19
75 0.2
76 0.24
77 0.28
78 0.3
79 0.28
80 0.31
81 0.29
82 0.27
83 0.31
84 0.3
85 0.29
86 0.29
87 0.32
88 0.37
89 0.43
90 0.46
91 0.5
92 0.55
93 0.62
94 0.67
95 0.74
96 0.75
97 0.76
98 0.8
99 0.82
100 0.85
101 0.82
102 0.79
103 0.72
104 0.69