Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HRJ4

Protein Details
Accession A0A2V5HRJ4   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
148-171QENENAPKPRPKKHRELKTSFETSHydrophilic
NLS Segment(s)
PositionSequence
155-162KPRPKKHR
Subcellular Location(s) nucl 15.5, cyto_nucl 10, cysk 7, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016192  APOBEC/CMP_deaminase_Zn-bd  
IPR002125  CMP_dCMP_dom  
IPR016193  Cytidine_deaminase-like  
Gene Ontology GO:0019239  F:deaminase activity  
GO:0016814  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines  
GO:0008270  F:zinc ion binding  
GO:0006139  P:nucleobase-containing compound metabolic process  
Pfam View protein in Pfam  
PF00383  dCMP_cyt_deam_1  
PROSITE View protein in PROSITE  
PS00903  CYT_DCMP_DEAMINASES_1  
PS51747  CYT_DCMP_DEAMINASES_2  
CDD cd01285  nucleoside_deaminase  
Amino Acid Sequences MDSRHAYFMKQALIMGEKALETGETPVGCVLVYKNEIVGSGMNDTNKSMNGTRHAEFIAIEQMLENHPRSLLRSTDLYVTVEPCVMCASALRQYQIRTVYFGCGNDRFGGTGSILSLHSDLSIDPPYVVHGGLFREEAIMLLRRFYIQENENAPKPRPKKHRELKTSFETSIPGSQASSPTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.15
4 0.12
5 0.11
6 0.11
7 0.08
8 0.06
9 0.08
10 0.11
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.1
17 0.09
18 0.1
19 0.12
20 0.12
21 0.12
22 0.12
23 0.13
24 0.13
25 0.13
26 0.1
27 0.11
28 0.13
29 0.13
30 0.13
31 0.14
32 0.14
33 0.14
34 0.15
35 0.15
36 0.16
37 0.22
38 0.26
39 0.25
40 0.26
41 0.26
42 0.23
43 0.21
44 0.19
45 0.16
46 0.12
47 0.11
48 0.09
49 0.09
50 0.1
51 0.12
52 0.12
53 0.09
54 0.09
55 0.1
56 0.12
57 0.14
58 0.14
59 0.14
60 0.14
61 0.15
62 0.16
63 0.17
64 0.16
65 0.14
66 0.13
67 0.11
68 0.11
69 0.1
70 0.08
71 0.08
72 0.06
73 0.06
74 0.05
75 0.06
76 0.11
77 0.12
78 0.13
79 0.14
80 0.14
81 0.18
82 0.21
83 0.19
84 0.16
85 0.16
86 0.17
87 0.17
88 0.17
89 0.17
90 0.15
91 0.16
92 0.14
93 0.14
94 0.12
95 0.11
96 0.11
97 0.09
98 0.08
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.08
110 0.08
111 0.08
112 0.08
113 0.09
114 0.1
115 0.1
116 0.07
117 0.07
118 0.08
119 0.09
120 0.1
121 0.08
122 0.08
123 0.08
124 0.08
125 0.09
126 0.13
127 0.12
128 0.12
129 0.13
130 0.13
131 0.14
132 0.16
133 0.2
134 0.17
135 0.23
136 0.29
137 0.33
138 0.39
139 0.42
140 0.43
141 0.46
142 0.49
143 0.53
144 0.58
145 0.62
146 0.67
147 0.74
148 0.82
149 0.83
150 0.86
151 0.84
152 0.82
153 0.8
154 0.7
155 0.6
156 0.51
157 0.43
158 0.4
159 0.33
160 0.24
161 0.19
162 0.2