Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HM41

Protein Details
Accession A0A2V5HM41    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
7-28AKLKLKLKSIFRKKKTDQEDSEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 9.333, nucl 8.5, cyto_nucl 7.833, cyto 6
Family & Domain DBs
Amino Acid Sequences MAPAFIAKLKLKLKSIFRKKKTDQEDSEATPAADVAAAAEPQADAPAETPAEGAKPEPTEPVTSSTAPVLELNTGAPTAETVAEDHAAEKKAEAAAEAAADKPAETVGQAKAEESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.67
3 0.7
4 0.73
5 0.79
6 0.8
7 0.83
8 0.81
9 0.8
10 0.74
11 0.7
12 0.69
13 0.61
14 0.57
15 0.48
16 0.39
17 0.29
18 0.23
19 0.16
20 0.1
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.05
30 0.04
31 0.03
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.06
39 0.06
40 0.06
41 0.06
42 0.07
43 0.08
44 0.09
45 0.1
46 0.11
47 0.12
48 0.15
49 0.16
50 0.15
51 0.16
52 0.15
53 0.14
54 0.13
55 0.12
56 0.08
57 0.06
58 0.06
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.04
65 0.05
66 0.05
67 0.05
68 0.05
69 0.06
70 0.07
71 0.07
72 0.08
73 0.11
74 0.12
75 0.11
76 0.11
77 0.12
78 0.12
79 0.12
80 0.12
81 0.09
82 0.08
83 0.09
84 0.1
85 0.08
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.06
92 0.07
93 0.09
94 0.11
95 0.15
96 0.15