Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5I727

Protein Details
Accession A0A2V5I727    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-40LELKSSWRGLWRRGRERKKGRERRVKVGKERGVREBasic
NLS Segment(s)
PositionSequence
13-37RGLWRRGRERKKGRERRVKVGKERG
158-168APRRRRPCKKK
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 9, cyto 4
Family & Domain DBs
Amino Acid Sequences MTARELELKSSWRGLWRRGRERKKGRERRVKVGKERGVREGWLWWRWRYSLSVLYVQYLSASAAQVQCKSPSVCLSVTLSGGRGKPDEGLRLCSSRTWMVPGKGNQPTHRPNPNLLISRLKDVFASPKIPLGDDEFDRGESLECLSKRVDRVAANGSAPRRRRPCKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.56
4 0.64
5 0.72
6 0.8
7 0.83
8 0.89
9 0.92
10 0.93
11 0.93
12 0.93
13 0.94
14 0.9
15 0.9
16 0.9
17 0.89
18 0.87
19 0.86
20 0.83
21 0.8
22 0.77
23 0.71
24 0.62
25 0.53
26 0.45
27 0.41
28 0.38
29 0.35
30 0.35
31 0.32
32 0.32
33 0.32
34 0.32
35 0.28
36 0.26
37 0.26
38 0.26
39 0.29
40 0.27
41 0.27
42 0.26
43 0.23
44 0.19
45 0.14
46 0.11
47 0.07
48 0.06
49 0.07
50 0.09
51 0.1
52 0.11
53 0.12
54 0.13
55 0.15
56 0.15
57 0.14
58 0.14
59 0.16
60 0.14
61 0.15
62 0.16
63 0.14
64 0.14
65 0.13
66 0.12
67 0.11
68 0.12
69 0.11
70 0.1
71 0.09
72 0.11
73 0.12
74 0.16
75 0.15
76 0.19
77 0.2
78 0.21
79 0.21
80 0.19
81 0.2
82 0.17
83 0.16
84 0.16
85 0.18
86 0.19
87 0.25
88 0.27
89 0.32
90 0.37
91 0.39
92 0.38
93 0.41
94 0.45
95 0.47
96 0.52
97 0.47
98 0.44
99 0.47
100 0.51
101 0.47
102 0.44
103 0.44
104 0.37
105 0.4
106 0.38
107 0.32
108 0.26
109 0.23
110 0.27
111 0.22
112 0.23
113 0.18
114 0.22
115 0.22
116 0.22
117 0.22
118 0.21
119 0.22
120 0.2
121 0.23
122 0.2
123 0.2
124 0.2
125 0.19
126 0.15
127 0.12
128 0.13
129 0.16
130 0.15
131 0.16
132 0.18
133 0.22
134 0.23
135 0.26
136 0.29
137 0.25
138 0.29
139 0.33
140 0.34
141 0.32
142 0.35
143 0.37
144 0.41
145 0.44
146 0.49
147 0.54
148 0.61