Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HLR0

Protein Details
Accession A0A2V5HLR0    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-110FTAAKKKKSSHVKRRNLSPRSTRDKKRIDCRPVVRDKEYHydrophilic
NLS Segment(s)
PositionSequence
75-98AKKKKSSHVKRRNLSPRSTRDKKR
Subcellular Location(s) mito 19.5, mito_nucl 12.833, nucl 5, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences MQRNMRPAIPTIPRPVMTSHPRLRFVYLLCWLCIQLSRIYTSLLPIHHADLLINTFNRHQILRSSNGPDLPFTAAKKKKSSHVKRRNLSPRSTRDKKRIDCRPVVRDKEYSWYGEAPVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.42
4 0.43
5 0.47
6 0.49
7 0.5
8 0.53
9 0.53
10 0.53
11 0.48
12 0.43
13 0.39
14 0.38
15 0.33
16 0.29
17 0.28
18 0.25
19 0.22
20 0.22
21 0.19
22 0.14
23 0.13
24 0.15
25 0.15
26 0.16
27 0.15
28 0.15
29 0.16
30 0.14
31 0.15
32 0.14
33 0.14
34 0.13
35 0.13
36 0.11
37 0.09
38 0.1
39 0.09
40 0.09
41 0.08
42 0.08
43 0.1
44 0.11
45 0.1
46 0.1
47 0.12
48 0.15
49 0.18
50 0.21
51 0.23
52 0.23
53 0.25
54 0.25
55 0.21
56 0.19
57 0.18
58 0.17
59 0.15
60 0.24
61 0.27
62 0.3
63 0.36
64 0.37
65 0.43
66 0.53
67 0.62
68 0.64
69 0.7
70 0.77
71 0.78
72 0.86
73 0.88
74 0.83
75 0.8
76 0.78
77 0.77
78 0.77
79 0.79
80 0.77
81 0.76
82 0.81
83 0.81
84 0.82
85 0.83
86 0.82
87 0.82
88 0.83
89 0.83
90 0.83
91 0.81
92 0.75
93 0.69
94 0.63
95 0.61
96 0.55
97 0.48
98 0.41
99 0.35