Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V5IRJ0

Protein Details
Accession A0A2V5IRJ0    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
114-140SPATTAKPVEKPRRKLRARKAAMKLTPHydrophilic
NLS Segment(s)
PositionSequence
121-135PVEKPRRKLRARKAA
Subcellular Location(s) extr 12, mito 6, plas 3, nucl 2, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR045226  Dsc3  
IPR025390  Dsc3_C  
IPR019413  Dsc3_ub-like_dom  
IPR000361  FeS_biogenesis  
IPR016092  FeS_cluster_insertion  
IPR035903  HesB-like_dom_sf  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0044695  C:Dsc E3 ubiquitin ligase complex  
GO:0051536  F:iron-sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF13373  Dsc3_C  
PF10302  Dsc3_N  
PF01521  Fe-S_biosyn  
Amino Acid Sequences MQSSVTSSATLLSLLRQSSSRRTAQTCRLFSSYGNSQRSSSKRELQTATAYRPHSLPTSFPPPRSPGSSDTSIAADFPSFREMTSPQLPGQQAYSPNINLNEAESQKPKPVETSPATTAKPVEKPRRKLRARKAAMKLTPVAIEQLRKLLSQPEPKLIRVGVKNRGCSGLAYHLEYVEKPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNIKKSTMSTPTLLTPDRMLDLNDSTSTPLYVIIRFSASIPDLPLDIFSPETTTSAGLKQLIRTRLPPNLSSHRLRLIYAGRGLEDATPLAASLKLPPSSSARSTPRPPEDDESTTTSKGKGKAPVRDPPRLYIHCSIGDIVLSAGDLAAEAAIASTIRQPQDSDSGDEDGNDGSPTGSRRNRHQGSSSSALDSAGGTTTPAPRGFDRLLAAGFTPAEVTALRSQFMAIQAVSRTPDTMPSGAELREMEDRWMDEGSSAMAAGGGATGGGGAGGGGEGISFADDDGGFGPGSRGAMDDMLWGAVMGFFWPVGCAMWLRREEGVWSWRKGFAVFVGVVVNVAFGAMRIMN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.18
4 0.22
5 0.3
6 0.36
7 0.4
8 0.43
9 0.49
10 0.56
11 0.63
12 0.69
13 0.64
14 0.63
15 0.6
16 0.55
17 0.49
18 0.48
19 0.48
20 0.47
21 0.48
22 0.44
23 0.42
24 0.49
25 0.54
26 0.54
27 0.52
28 0.52
29 0.54
30 0.6
31 0.62
32 0.57
33 0.62
34 0.6
35 0.59
36 0.56
37 0.51
38 0.45
39 0.42
40 0.4
41 0.35
42 0.3
43 0.28
44 0.28
45 0.38
46 0.4
47 0.42
48 0.44
49 0.45
50 0.48
51 0.5
52 0.47
53 0.41
54 0.43
55 0.45
56 0.41
57 0.37
58 0.34
59 0.29
60 0.25
61 0.2
62 0.14
63 0.11
64 0.11
65 0.14
66 0.12
67 0.12
68 0.15
69 0.15
70 0.21
71 0.26
72 0.27
73 0.24
74 0.3
75 0.31
76 0.29
77 0.3
78 0.28
79 0.26
80 0.27
81 0.3
82 0.25
83 0.28
84 0.28
85 0.27
86 0.22
87 0.21
88 0.24
89 0.22
90 0.25
91 0.25
92 0.26
93 0.3
94 0.32
95 0.3
96 0.28
97 0.29
98 0.33
99 0.34
100 0.39
101 0.38
102 0.42
103 0.42
104 0.39
105 0.39
106 0.35
107 0.39
108 0.42
109 0.49
110 0.53
111 0.62
112 0.71
113 0.79
114 0.84
115 0.87
116 0.88
117 0.88
118 0.87
119 0.88
120 0.86
121 0.85
122 0.79
123 0.72
124 0.63
125 0.54
126 0.46
127 0.36
128 0.31
129 0.23
130 0.22
131 0.18
132 0.2
133 0.19
134 0.18
135 0.18
136 0.21
137 0.27
138 0.34
139 0.36
140 0.41
141 0.42
142 0.43
143 0.44
144 0.39
145 0.39
146 0.36
147 0.4
148 0.41
149 0.43
150 0.45
151 0.44
152 0.45
153 0.39
154 0.33
155 0.29
156 0.27
157 0.24
158 0.24
159 0.23
160 0.21
161 0.21
162 0.21
163 0.21
164 0.16
165 0.14
166 0.12
167 0.12
168 0.14
169 0.13
170 0.13
171 0.12
172 0.1
173 0.11
174 0.11
175 0.1
176 0.08
177 0.09
178 0.09
179 0.06
180 0.05
181 0.05
182 0.06
183 0.07
184 0.07
185 0.07
186 0.08
187 0.08
188 0.07
189 0.06
190 0.08
191 0.08
192 0.08
193 0.08
194 0.09
195 0.09
196 0.1
197 0.1
198 0.08
199 0.09
200 0.12
201 0.16
202 0.17
203 0.22
204 0.22
205 0.26
206 0.31
207 0.36
208 0.43
209 0.47
210 0.56
211 0.58
212 0.66
213 0.64
214 0.61
215 0.56
216 0.48
217 0.48
218 0.43
219 0.39
220 0.31
221 0.29
222 0.29
223 0.31
224 0.27
225 0.2
226 0.15
227 0.14
228 0.13
229 0.12
230 0.11
231 0.1
232 0.1
233 0.1
234 0.1
235 0.1
236 0.1
237 0.09
238 0.09
239 0.07
240 0.08
241 0.08
242 0.08
243 0.08
244 0.07
245 0.08
246 0.08
247 0.08
248 0.08
249 0.08
250 0.08
251 0.08
252 0.08
253 0.07
254 0.07
255 0.07
256 0.06
257 0.06
258 0.06
259 0.05
260 0.06
261 0.06
262 0.07
263 0.07
264 0.07
265 0.08
266 0.08
267 0.09
268 0.1
269 0.1
270 0.13
271 0.17
272 0.2
273 0.2
274 0.23
275 0.25
276 0.28
277 0.3
278 0.29
279 0.3
280 0.33
281 0.38
282 0.36
283 0.35
284 0.35
285 0.33
286 0.31
287 0.29
288 0.25
289 0.22
290 0.22
291 0.2
292 0.16
293 0.15
294 0.16
295 0.12
296 0.1
297 0.07
298 0.05
299 0.05
300 0.04
301 0.05
302 0.04
303 0.04
304 0.06
305 0.09
306 0.1
307 0.11
308 0.12
309 0.16
310 0.19
311 0.21
312 0.25
313 0.27
314 0.32
315 0.36
316 0.42
317 0.43
318 0.43
319 0.44
320 0.43
321 0.43
322 0.41
323 0.39
324 0.37
325 0.34
326 0.32
327 0.29
328 0.26
329 0.25
330 0.26
331 0.27
332 0.3
333 0.33
334 0.41
335 0.45
336 0.52
337 0.54
338 0.58
339 0.56
340 0.52
341 0.55
342 0.48
343 0.48
344 0.44
345 0.41
346 0.34
347 0.33
348 0.28
349 0.2
350 0.18
351 0.13
352 0.09
353 0.06
354 0.04
355 0.04
356 0.03
357 0.02
358 0.02
359 0.02
360 0.02
361 0.02
362 0.02
363 0.02
364 0.02
365 0.02
366 0.03
367 0.05
368 0.08
369 0.09
370 0.1
371 0.11
372 0.13
373 0.19
374 0.21
375 0.22
376 0.21
377 0.22
378 0.22
379 0.21
380 0.2
381 0.13
382 0.12
383 0.09
384 0.07
385 0.05
386 0.07
387 0.09
388 0.16
389 0.21
390 0.23
391 0.31
392 0.42
393 0.46
394 0.48
395 0.52
396 0.49
397 0.51
398 0.55
399 0.49
400 0.39
401 0.35
402 0.31
403 0.26
404 0.21
405 0.14
406 0.08
407 0.07
408 0.06
409 0.07
410 0.09
411 0.12
412 0.13
413 0.15
414 0.15
415 0.21
416 0.21
417 0.22
418 0.22
419 0.2
420 0.2
421 0.18
422 0.17
423 0.13
424 0.12
425 0.09
426 0.08
427 0.06
428 0.07
429 0.06
430 0.09
431 0.13
432 0.14
433 0.14
434 0.14
435 0.15
436 0.16
437 0.17
438 0.16
439 0.11
440 0.12
441 0.13
442 0.14
443 0.15
444 0.14
445 0.14
446 0.12
447 0.16
448 0.17
449 0.17
450 0.16
451 0.17
452 0.19
453 0.17
454 0.19
455 0.15
456 0.15
457 0.18
458 0.18
459 0.17
460 0.17
461 0.18
462 0.18
463 0.18
464 0.15
465 0.11
466 0.11
467 0.1
468 0.08
469 0.07
470 0.06
471 0.05
472 0.05
473 0.04
474 0.04
475 0.03
476 0.02
477 0.02
478 0.02
479 0.02
480 0.02
481 0.02
482 0.02
483 0.02
484 0.02
485 0.02
486 0.02
487 0.02
488 0.02
489 0.02
490 0.03
491 0.03
492 0.03
493 0.05
494 0.05
495 0.06
496 0.06
497 0.08
498 0.07
499 0.07
500 0.08
501 0.08
502 0.09
503 0.08
504 0.08
505 0.08
506 0.09
507 0.09
508 0.1
509 0.09
510 0.09
511 0.08
512 0.07
513 0.06
514 0.06
515 0.06
516 0.05
517 0.05
518 0.04
519 0.05
520 0.05
521 0.06
522 0.06
523 0.07
524 0.09
525 0.12
526 0.19
527 0.21
528 0.23
529 0.24
530 0.24
531 0.26
532 0.3
533 0.37
534 0.36
535 0.39
536 0.39
537 0.41
538 0.41
539 0.39
540 0.34
541 0.27
542 0.26
543 0.22
544 0.2
545 0.18
546 0.17
547 0.17
548 0.14
549 0.12
550 0.06
551 0.06
552 0.05
553 0.03