Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V5GXD3

Protein Details
Accession A0A2V5GXD3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
15-35VSTSNRPKRKVRTRSVIRGGVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 16, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MGMIAAAEDLIACSVSTSNRPKRKVRTRSVIRGGVAGAALSINWSSERKVLGLGLGNRVVATGHTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.07
3 0.13
4 0.22
5 0.32
6 0.4
7 0.46
8 0.53
9 0.63
10 0.73
11 0.76
12 0.77
13 0.78
14 0.79
15 0.83
16 0.82
17 0.75
18 0.64
19 0.55
20 0.45
21 0.35
22 0.25
23 0.15
24 0.08
25 0.04
26 0.04
27 0.03
28 0.03
29 0.03
30 0.05
31 0.06
32 0.07
33 0.09
34 0.1
35 0.1
36 0.11
37 0.11
38 0.12
39 0.18
40 0.18
41 0.21
42 0.21
43 0.2
44 0.19
45 0.19
46 0.17