Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HSX1

Protein Details
Accession A0A2V5HSX1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-93EPCPSRVFRSAKKKKKKKKKKVKKKRKSSEKQKSPSSRLABasic
NLS Segment(s)
PositionSequence
62-87RSAKKKKKKKKKKVKKKRKSSEKQKS
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLTVSELSAPPNLRFLHMCGRSPYAASDRFRRLRDSPATQPSGIYDVQCICLEEPCPSRVFRSAKKKKKKKKKKVKKKRKSSEKQKSPSSRLAYLYVHWAVHPRSRANSFARVGKNFRKRGMPLVHPHKLQLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.32
4 0.33
5 0.36
6 0.34
7 0.37
8 0.35
9 0.35
10 0.34
11 0.3
12 0.32
13 0.33
14 0.36
15 0.41
16 0.47
17 0.48
18 0.5
19 0.47
20 0.49
21 0.53
22 0.53
23 0.52
24 0.53
25 0.55
26 0.49
27 0.47
28 0.39
29 0.35
30 0.28
31 0.2
32 0.14
33 0.11
34 0.13
35 0.13
36 0.13
37 0.1
38 0.11
39 0.11
40 0.13
41 0.14
42 0.14
43 0.15
44 0.15
45 0.16
46 0.22
47 0.26
48 0.3
49 0.4
50 0.49
51 0.58
52 0.69
53 0.78
54 0.82
55 0.89
56 0.92
57 0.92
58 0.93
59 0.95
60 0.95
61 0.96
62 0.97
63 0.97
64 0.97
65 0.96
66 0.96
67 0.96
68 0.96
69 0.96
70 0.95
71 0.91
72 0.9
73 0.87
74 0.81
75 0.79
76 0.72
77 0.64
78 0.56
79 0.51
80 0.42
81 0.35
82 0.34
83 0.28
84 0.23
85 0.19
86 0.21
87 0.2
88 0.24
89 0.27
90 0.25
91 0.29
92 0.31
93 0.37
94 0.37
95 0.42
96 0.41
97 0.44
98 0.48
99 0.47
100 0.52
101 0.56
102 0.62
103 0.6
104 0.61
105 0.61
106 0.58
107 0.63
108 0.64
109 0.63
110 0.63
111 0.67
112 0.7
113 0.64