Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HEP8

Protein Details
Accession A0A2V5HEP8    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
324-351GKSGWRKIGGRRRPEAFKRKDWKKLLLWBasic
NLS Segment(s)
PositionSequence
325-347KSGWRKIGGRRRPEAFKRKDWKK
Subcellular Location(s) cyto_nucl 11.5, nucl 11, cyto 10, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002110  Ankyrin_rpt  
IPR036770  Ankyrin_rpt-contain_sf  
IPR036047  F-box-like_dom_sf  
IPR001810  F-box_dom  
Pfam View protein in Pfam  
PF13606  Ank_3  
PROSITE View protein in PROSITE  
PS50181  FBOX  
CDD cd09917  F-box_SF  
Amino Acid Sequences MMDDLSNDEYWWGIAKRAAEDMNPVESLEGMYYHGPEYPQSPAIVLEDDRQWRSLELARLPAEMFLECFEHMTNRELANFSQTCKYLYLMLRPLLRKKARQFALATLGEYRKLLWIDRNGRALYKDWQTDLYPIPFREPLFEAAEAGNYSLVEGYLRAGVSPNAYGLEGWPLLPWAARNDRLEIVQLLLNHPDIDVGLVPGEDQLFPECSPLPLDILCNHHYCWSSHSQRELILVDSVVRSLLSKGATFGHFNAFQYISASPHRLRFMRAAMENGSDLRAVAIDMLQPTWYRRFPLARHAACQPDPRYLEFVVRAAPEILGNIGKSGWRKIGGRRRPEAFKRKDWKKLLLWLQRVYDLVPGRDFDRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.19
4 0.23
5 0.25
6 0.21
7 0.26
8 0.27
9 0.27
10 0.25
11 0.23
12 0.19
13 0.18
14 0.17
15 0.12
16 0.1
17 0.08
18 0.09
19 0.1
20 0.1
21 0.11
22 0.11
23 0.12
24 0.14
25 0.16
26 0.17
27 0.17
28 0.17
29 0.16
30 0.17
31 0.18
32 0.17
33 0.16
34 0.2
35 0.24
36 0.25
37 0.26
38 0.25
39 0.23
40 0.25
41 0.28
42 0.28
43 0.26
44 0.31
45 0.31
46 0.31
47 0.31
48 0.29
49 0.24
50 0.18
51 0.16
52 0.1
53 0.11
54 0.1
55 0.1
56 0.1
57 0.11
58 0.13
59 0.15
60 0.17
61 0.16
62 0.18
63 0.19
64 0.19
65 0.25
66 0.24
67 0.23
68 0.24
69 0.24
70 0.24
71 0.24
72 0.24
73 0.23
74 0.24
75 0.28
76 0.28
77 0.32
78 0.36
79 0.38
80 0.43
81 0.47
82 0.5
83 0.52
84 0.54
85 0.6
86 0.58
87 0.59
88 0.56
89 0.5
90 0.53
91 0.45
92 0.39
93 0.33
94 0.31
95 0.26
96 0.23
97 0.2
98 0.15
99 0.15
100 0.15
101 0.17
102 0.25
103 0.31
104 0.35
105 0.4
106 0.37
107 0.38
108 0.38
109 0.35
110 0.31
111 0.3
112 0.27
113 0.23
114 0.25
115 0.25
116 0.26
117 0.26
118 0.25
119 0.23
120 0.21
121 0.23
122 0.23
123 0.22
124 0.22
125 0.22
126 0.21
127 0.2
128 0.2
129 0.18
130 0.16
131 0.16
132 0.13
133 0.12
134 0.08
135 0.05
136 0.05
137 0.04
138 0.04
139 0.03
140 0.03
141 0.04
142 0.05
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.07
149 0.07
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.06
162 0.08
163 0.12
164 0.15
165 0.16
166 0.18
167 0.19
168 0.19
169 0.19
170 0.16
171 0.13
172 0.11
173 0.11
174 0.09
175 0.09
176 0.09
177 0.08
178 0.08
179 0.07
180 0.05
181 0.05
182 0.04
183 0.04
184 0.03
185 0.03
186 0.03
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.06
193 0.07
194 0.08
195 0.08
196 0.08
197 0.09
198 0.09
199 0.09
200 0.08
201 0.09
202 0.1
203 0.14
204 0.16
205 0.17
206 0.17
207 0.19
208 0.2
209 0.19
210 0.22
211 0.26
212 0.3
213 0.31
214 0.34
215 0.32
216 0.31
217 0.33
218 0.3
219 0.22
220 0.17
221 0.14
222 0.11
223 0.1
224 0.1
225 0.07
226 0.06
227 0.06
228 0.05
229 0.08
230 0.08
231 0.08
232 0.09
233 0.12
234 0.13
235 0.14
236 0.15
237 0.17
238 0.17
239 0.17
240 0.19
241 0.17
242 0.16
243 0.16
244 0.16
245 0.14
246 0.15
247 0.19
248 0.18
249 0.21
250 0.26
251 0.25
252 0.27
253 0.28
254 0.3
255 0.33
256 0.32
257 0.31
258 0.29
259 0.29
260 0.27
261 0.23
262 0.2
263 0.13
264 0.12
265 0.09
266 0.07
267 0.06
268 0.05
269 0.05
270 0.06
271 0.07
272 0.07
273 0.08
274 0.09
275 0.12
276 0.17
277 0.18
278 0.19
279 0.23
280 0.29
281 0.31
282 0.41
283 0.48
284 0.46
285 0.48
286 0.5
287 0.52
288 0.49
289 0.55
290 0.47
291 0.44
292 0.44
293 0.43
294 0.42
295 0.37
296 0.37
297 0.31
298 0.29
299 0.25
300 0.23
301 0.22
302 0.19
303 0.18
304 0.14
305 0.12
306 0.13
307 0.11
308 0.1
309 0.09
310 0.09
311 0.12
312 0.14
313 0.17
314 0.19
315 0.22
316 0.26
317 0.36
318 0.47
319 0.53
320 0.61
321 0.65
322 0.68
323 0.74
324 0.81
325 0.82
326 0.79
327 0.8
328 0.82
329 0.84
330 0.87
331 0.84
332 0.82
333 0.78
334 0.8
335 0.79
336 0.78
337 0.76
338 0.72
339 0.67
340 0.61
341 0.55
342 0.45
343 0.42
344 0.36
345 0.31
346 0.28
347 0.27