Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HCJ0

Protein Details
Accession A0A2V5HCJ0    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
45-103GRQALKRERKQRYEYRKKKEKEHREKNMKQDEKQEKKKEKHKEEEREKNVKRQKTNKSNBasic
NLS Segment(s)
PositionSequence
49-101LKRERKQRYEYRKKKEKEHREKNMKQDEKQEKKKEKHKEEEREKNVKRQKTNK
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MVSQPVRSDHLTKHGEKECGRCRELGHFSKDCPRKVFYKGLMELGRQALKRERKQRYEYRKKKEKEHREKNMKQDEKQEKKKEKHKEEEREKNVKRQKTNKSN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.5
3 0.5
4 0.56
5 0.56
6 0.57
7 0.56
8 0.49
9 0.45
10 0.47
11 0.53
12 0.49
13 0.48
14 0.42
15 0.43
16 0.51
17 0.55
18 0.5
19 0.45
20 0.41
21 0.37
22 0.41
23 0.46
24 0.41
25 0.43
26 0.4
27 0.43
28 0.41
29 0.38
30 0.34
31 0.3
32 0.28
33 0.2
34 0.21
35 0.22
36 0.29
37 0.36
38 0.44
39 0.5
40 0.54
41 0.62
42 0.7
43 0.75
44 0.78
45 0.8
46 0.81
47 0.83
48 0.8
49 0.83
50 0.84
51 0.84
52 0.84
53 0.85
54 0.85
55 0.86
56 0.89
57 0.88
58 0.88
59 0.83
60 0.75
61 0.75
62 0.75
63 0.74
64 0.78
65 0.79
66 0.78
67 0.8
68 0.86
69 0.87
70 0.86
71 0.86
72 0.86
73 0.87
74 0.88
75 0.9
76 0.91
77 0.91
78 0.85
79 0.84
80 0.82
81 0.8
82 0.79
83 0.78