Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NLW6

Protein Details
Accession B8NLW6   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-93IEYRKAHRRRASKSKKLLKDBasic
NLS Segment(s)
PositionSequence
77-92RKAHRRRASKSKKLLK
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 7
Family & Domain DBs
Amino Acid Sequences MADIQRELRRPNTQRRVFALTQTTPTDLVRSKLSTSEIQSRALSSLPDDLLANIPDDSSSYSLFEGFQASQDDIEYRKAHRRRASKSKKLLKDGENRAALPSTPAELKKERDLLSRRMELMGVRKNMCSSEIHDIDNKIANLHNMRKIVLDRLAGLEMEEAELEHERGWTWLDYRSLILTLENSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.74
4 0.66
5 0.64
6 0.6
7 0.52
8 0.49
9 0.44
10 0.4
11 0.32
12 0.31
13 0.29
14 0.23
15 0.22
16 0.22
17 0.22
18 0.21
19 0.23
20 0.26
21 0.25
22 0.28
23 0.36
24 0.34
25 0.34
26 0.34
27 0.32
28 0.29
29 0.26
30 0.21
31 0.13
32 0.14
33 0.12
34 0.12
35 0.11
36 0.11
37 0.12
38 0.12
39 0.12
40 0.09
41 0.08
42 0.08
43 0.08
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.1
60 0.09
61 0.13
62 0.12
63 0.13
64 0.22
65 0.26
66 0.33
67 0.4
68 0.47
69 0.52
70 0.63
71 0.71
72 0.72
73 0.78
74 0.81
75 0.8
76 0.78
77 0.76
78 0.71
79 0.7
80 0.67
81 0.63
82 0.55
83 0.49
84 0.43
85 0.37
86 0.29
87 0.21
88 0.15
89 0.09
90 0.1
91 0.1
92 0.13
93 0.16
94 0.19
95 0.21
96 0.26
97 0.26
98 0.32
99 0.35
100 0.38
101 0.41
102 0.41
103 0.38
104 0.33
105 0.33
106 0.27
107 0.3
108 0.3
109 0.28
110 0.26
111 0.26
112 0.26
113 0.26
114 0.26
115 0.2
116 0.17
117 0.22
118 0.23
119 0.24
120 0.26
121 0.26
122 0.26
123 0.29
124 0.25
125 0.18
126 0.17
127 0.19
128 0.22
129 0.26
130 0.3
131 0.26
132 0.27
133 0.29
134 0.29
135 0.3
136 0.28
137 0.24
138 0.2
139 0.21
140 0.22
141 0.19
142 0.17
143 0.14
144 0.1
145 0.09
146 0.08
147 0.06
148 0.07
149 0.08
150 0.08
151 0.08
152 0.08
153 0.08
154 0.09
155 0.11
156 0.11
157 0.12
158 0.16
159 0.18
160 0.19
161 0.2
162 0.21
163 0.19
164 0.18
165 0.18