FuNGI

A0A2V5HGS0

Protein Details

Accession

A0A2V5HGS0

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
11-44	PSDSTGSAKRKPVRRDPEKRRQQNIQAQKKYSKC	Hydrophilic

NLS Segment(s)

Position	Sequence
19-31	KRKPVRRDPEKRR

Subcellular Location(s)

nucl 12, cyto 8, pero 6

Family & Domain DBs

InterPro	View protein in InterPro IPR021833 DUF3425
Pfam	View protein in Pfam PF11905 DUF3425

Amino Acid Sequences

MPMQTQGSTEPSDSTGSAKRKPVRRDPEKRRQQNIQAQKKYSKCMSLLTLVSGEKLRKRLENLEALAASAAQNHAVERTAAVENDTSEAAVAQGPSTFLPHIATNGIPASEVSGISVPFPSAGIPGNPCTSLDEFSAALSLWEPSTCATNLDCTSSSLAMFDSTIYAPPPDDLSPSFLIPDDHGDNIGGSHRVIAIKCGCLKPHIRVQTHSPYPFRSGEIRIIMLEPGAPAADPYTNHIRIDLVCTMTALYTLGTHIGVNESMLCADESFSPFYRPSAACADELVKANMVGTVQRIFKTLKPDLRPNREQIMIEHHPYIDILPFPTLRRNLLILQTELDEDEFMDDIISGLVCWGGAGMGKRDRQNSVGRHPTGTPWDVRSWEAKVWFLKKYWALLGGEDGELVRQSEWWRGLRGEDEEVFDQSDSTPADSPLFYSTLGI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.22
2	0.26
3	0.3
4	0.35
5	0.42
6	0.49
7	0.56
8	0.65
9	0.71
10	0.75
11	0.8
12	0.85
13	0.87
14	0.9
15	0.93
16	0.94
17	0.91
18	0.9
19	0.89
20	0.89
21	0.89
22	0.88
23	0.86
24	0.83
25	0.83
26	0.78
27	0.74
28	0.69
29	0.63
30	0.54
31	0.49
32	0.47
33	0.44
34	0.4
35	0.35
36	0.33
37	0.27
38	0.28
39	0.26
40	0.26
41	0.25
42	0.3
43	0.31
44	0.33
45	0.39
46	0.44
47	0.48
48	0.52
49	0.49
50	0.48
51	0.44
52	0.4
53	0.34
54	0.27
55	0.2
56	0.13
57	0.11
58	0.07
59	0.07
60	0.07
61	0.08
62	0.09
63	0.09
64	0.08
65	0.11
66	0.12
67	0.12
68	0.13
69	0.13
70	0.12
71	0.14
72	0.14
73	0.1
74	0.08
75	0.08
76	0.07
77	0.07
78	0.07
79	0.06
80	0.06
81	0.07
82	0.07
83	0.09
84	0.09
85	0.08
86	0.1
87	0.1
88	0.11
89	0.12
90	0.11
91	0.11
92	0.12
93	0.11
94	0.09
95	0.09
96	0.1
97	0.09
98	0.09
99	0.08
100	0.08
101	0.08
102	0.09
103	0.09
104	0.07
105	0.07
106	0.07
107	0.06
108	0.06
109	0.07
110	0.08
111	0.1
112	0.12
113	0.14
114	0.14
115	0.14
116	0.16
117	0.17
118	0.17
119	0.15
120	0.15
121	0.13
122	0.13
123	0.13
124	0.1
125	0.08
126	0.07
127	0.07
128	0.05
129	0.05
130	0.05
131	0.05
132	0.08
133	0.08
134	0.09
135	0.09
136	0.13
137	0.13
138	0.16
139	0.16
140	0.14
141	0.16
142	0.15
143	0.15
144	0.11
145	0.11
146	0.08
147	0.07
148	0.06
149	0.06
150	0.06
151	0.07
152	0.07
153	0.07
154	0.07
155	0.07
156	0.09
157	0.08
158	0.09
159	0.1
160	0.13
161	0.14
162	0.14
163	0.14
164	0.12
165	0.12
166	0.11
167	0.14
168	0.11
169	0.1
170	0.1
171	0.1
172	0.09
173	0.09
174	0.1
175	0.07
176	0.06
177	0.06
178	0.07
179	0.08
180	0.08
181	0.11
182	0.12
183	0.14
184	0.17
185	0.18
186	0.17
187	0.2
188	0.22
189	0.23
190	0.29
191	0.35
192	0.33
193	0.34
194	0.4
195	0.45
196	0.48
197	0.47
198	0.41
199	0.35
200	0.37
201	0.36
202	0.32
203	0.26
204	0.23
205	0.22
206	0.22
207	0.2
208	0.17
209	0.16
210	0.14
211	0.11
212	0.09
213	0.05
214	0.04
215	0.04
216	0.03
217	0.03
218	0.04
219	0.05
220	0.05
221	0.09
222	0.15
223	0.16
224	0.16
225	0.17
226	0.17
227	0.16
228	0.19
229	0.17
230	0.12
231	0.11
232	0.11
233	0.11
234	0.1
235	0.1
236	0.06
237	0.04
238	0.04
239	0.04
240	0.04
241	0.05
242	0.05
243	0.05
244	0.05
245	0.05
246	0.05
247	0.05
248	0.04
249	0.04
250	0.05
251	0.05
252	0.04
253	0.05
254	0.06
255	0.08
256	0.1
257	0.11
258	0.12
259	0.12
260	0.13
261	0.17
262	0.16
263	0.18
264	0.2
265	0.21
266	0.19
267	0.2
268	0.21
269	0.19
270	0.2
271	0.18
272	0.13
273	0.11
274	0.11
275	0.11
276	0.09
277	0.07
278	0.07
279	0.1
280	0.11
281	0.12
282	0.14
283	0.15
284	0.18
285	0.25
286	0.3
287	0.34
288	0.38
289	0.48
290	0.56
291	0.63
292	0.65
293	0.62
294	0.6
295	0.56
296	0.51
297	0.43
298	0.42
299	0.37
300	0.35
301	0.31
302	0.26
303	0.23
304	0.23
305	0.21
306	0.14
307	0.11
308	0.09
309	0.1
310	0.11
311	0.13
312	0.19
313	0.2
314	0.2
315	0.21
316	0.23
317	0.23
318	0.28
319	0.3
320	0.25
321	0.24
322	0.23
323	0.21
324	0.19
325	0.16
326	0.11
327	0.08
328	0.08
329	0.07
330	0.06
331	0.05
332	0.05
333	0.05
334	0.05
335	0.05
336	0.04
337	0.04
338	0.04
339	0.03
340	0.03
341	0.03
342	0.03
343	0.05
344	0.07
345	0.11
346	0.17
347	0.22
348	0.26
349	0.3
350	0.32
351	0.35
352	0.42
353	0.44
354	0.49
355	0.54
356	0.52
357	0.51
358	0.5
359	0.5
360	0.48
361	0.44
362	0.38
363	0.32
364	0.34
365	0.33
366	0.34
367	0.34
368	0.31
369	0.31
370	0.3
371	0.31
372	0.34
373	0.37
374	0.38
375	0.36
376	0.39
377	0.38
378	0.39
379	0.37
380	0.35
381	0.32
382	0.29
383	0.31
384	0.26
385	0.23
386	0.19
387	0.17
388	0.12
389	0.12
390	0.12
391	0.09
392	0.09
393	0.11
394	0.18
395	0.23
396	0.25
397	0.28
398	0.28
399	0.31
400	0.33
401	0.35
402	0.34
403	0.31
404	0.32
405	0.31
406	0.31
407	0.29
408	0.24
409	0.21
410	0.16
411	0.18
412	0.14
413	0.15
414	0.15
415	0.15
416	0.17
417	0.17
418	0.18
419	0.18
420	0.18

A0A2V5HGS0

3D AlphaFold-predicted Structure Viewer