Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5H3C6

Protein Details
Accession A0A2V5H3C6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-132GISLVQKKIRHRKVTRMWYRRHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 11, cyto 8.5, mito 6, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006137  NADH_UbQ_OxRdtase-like_20kDa  
IPR006138  NADH_UQ_OxRdtase_20Kd_su  
Gene Ontology GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0046872  F:metal ion binding  
GO:0008137  F:NADH dehydrogenase (ubiquinone) activity  
GO:0048038  F:quinone binding  
Pfam View protein in Pfam  
PF01058  Oxidored_q6  
PROSITE View protein in PROSITE  
PS01150  COMPLEX1_20K  
Amino Acid Sequences MTFGLACCAVEMMHAAGPRYDIERLGMLFRASPRQADLLIVAGTLTNKMAPAFRQVYDQMPEPRFVISMGSCANGGGYYHYSYSVVRGCDRIVPVDVYVPGCPPTAEALLYGISLVQKKIRHRKVTRMWYRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.13
5 0.13
6 0.15
7 0.14
8 0.12
9 0.13
10 0.14
11 0.15
12 0.15
13 0.15
14 0.13
15 0.14
16 0.16
17 0.2
18 0.19
19 0.19
20 0.19
21 0.19
22 0.19
23 0.17
24 0.16
25 0.12
26 0.11
27 0.1
28 0.08
29 0.07
30 0.07
31 0.06
32 0.06
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.12
39 0.15
40 0.15
41 0.17
42 0.18
43 0.21
44 0.22
45 0.25
46 0.25
47 0.24
48 0.24
49 0.22
50 0.21
51 0.18
52 0.16
53 0.13
54 0.07
55 0.08
56 0.08
57 0.08
58 0.07
59 0.07
60 0.07
61 0.06
62 0.06
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.09
69 0.09
70 0.12
71 0.13
72 0.13
73 0.13
74 0.14
75 0.14
76 0.17
77 0.18
78 0.17
79 0.15
80 0.15
81 0.14
82 0.15
83 0.16
84 0.14
85 0.13
86 0.13
87 0.12
88 0.12
89 0.11
90 0.1
91 0.12
92 0.12
93 0.11
94 0.11
95 0.11
96 0.11
97 0.11
98 0.09
99 0.07
100 0.08
101 0.1
102 0.11
103 0.14
104 0.19
105 0.29
106 0.41
107 0.5
108 0.59
109 0.64
110 0.74
111 0.8
112 0.86