Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8MYL3

Protein Details
Accession B8MYL3   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
12-39NPPAINRSHNESRRRRRRLVNGTRNETAHydrophilic
NLS Segment(s)
PositionSequence
25-28RRRR
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MPRLNANGDIYNPPAINRSHNESRRRRRRLVNGTRNETAGDRSPFVVTHYDNDDSHDSEQTVDETLAADVDELIAAERQRAAERQREERGQRAEQGPQEQGPHQPGPQQSGQQQSGQHQPESHGHELQQLEPQQQSSELPPREPMPRERVAPQQGSEEPGEPLQPIRLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.25
4 0.26
5 0.33
6 0.39
7 0.47
8 0.57
9 0.64
10 0.74
11 0.79
12 0.84
13 0.84
14 0.84
15 0.87
16 0.88
17 0.89
18 0.88
19 0.87
20 0.85
21 0.79
22 0.69
23 0.59
24 0.49
25 0.41
26 0.36
27 0.28
28 0.22
29 0.22
30 0.22
31 0.2
32 0.21
33 0.22
34 0.16
35 0.17
36 0.19
37 0.21
38 0.2
39 0.24
40 0.24
41 0.22
42 0.22
43 0.2
44 0.17
45 0.15
46 0.15
47 0.12
48 0.11
49 0.08
50 0.07
51 0.07
52 0.06
53 0.06
54 0.05
55 0.04
56 0.03
57 0.03
58 0.03
59 0.02
60 0.03
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.07
67 0.1
68 0.12
69 0.18
70 0.22
71 0.27
72 0.31
73 0.36
74 0.37
75 0.41
76 0.43
77 0.38
78 0.39
79 0.35
80 0.35
81 0.31
82 0.32
83 0.27
84 0.23
85 0.23
86 0.2
87 0.2
88 0.21
89 0.2
90 0.17
91 0.2
92 0.2
93 0.23
94 0.24
95 0.25
96 0.24
97 0.29
98 0.3
99 0.29
100 0.3
101 0.29
102 0.35
103 0.34
104 0.32
105 0.26
106 0.27
107 0.3
108 0.35
109 0.35
110 0.28
111 0.26
112 0.3
113 0.3
114 0.28
115 0.28
116 0.23
117 0.23
118 0.22
119 0.23
120 0.18
121 0.18
122 0.18
123 0.18
124 0.25
125 0.24
126 0.25
127 0.27
128 0.29
129 0.35
130 0.38
131 0.39
132 0.37
133 0.41
134 0.43
135 0.45
136 0.51
137 0.52
138 0.52
139 0.47
140 0.46
141 0.43
142 0.43
143 0.4
144 0.33
145 0.27
146 0.24
147 0.23
148 0.17
149 0.17
150 0.2