Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HIF4

Protein Details
Accession A0A2V5HIF4    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
190-224HSLGQKRRPNKVHAQTRQRERREKGNRFRSRVGDEBasic
NLS Segment(s)
PositionSequence
195-217KRRPNKVHAQTRQRERREKGNRF
Subcellular Location(s) mito 13.5, mito_nucl 10.666, cyto_nucl 7.833, cyto 7, nucl 6.5
Family & Domain DBs
Amino Acid Sequences MAPPLSRTTSVQISLISYGHANGPVVQQPREARYYQILAYNIRHLPNPPRHLRVNATGLSRRLQKEFLQNDAVEAALVKVQQEIVNAVQEGCAQPLCSTAREELQQAASQTDTSPSLHGHASAELAVDGAEVDIVVTICCEEGRHRSVAFVEELARRLVTVKDGDGVLQPWALNVNKTHRDIEEGEDSEHSLGQKRRPNKVHAQTRQRERREKGNRFRSRVGDEDETDEIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.17
4 0.13
5 0.12
6 0.13
7 0.13
8 0.12
9 0.11
10 0.14
11 0.19
12 0.22
13 0.22
14 0.25
15 0.28
16 0.32
17 0.34
18 0.32
19 0.3
20 0.31
21 0.33
22 0.3
23 0.32
24 0.3
25 0.29
26 0.31
27 0.33
28 0.31
29 0.29
30 0.29
31 0.27
32 0.34
33 0.4
34 0.47
35 0.47
36 0.5
37 0.52
38 0.55
39 0.57
40 0.53
41 0.5
42 0.44
43 0.43
44 0.42
45 0.4
46 0.39
47 0.41
48 0.37
49 0.33
50 0.33
51 0.32
52 0.38
53 0.39
54 0.39
55 0.37
56 0.34
57 0.32
58 0.3
59 0.25
60 0.15
61 0.12
62 0.08
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.08
71 0.08
72 0.09
73 0.09
74 0.09
75 0.08
76 0.08
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.09
83 0.1
84 0.1
85 0.11
86 0.12
87 0.13
88 0.14
89 0.15
90 0.13
91 0.13
92 0.14
93 0.13
94 0.12
95 0.1
96 0.1
97 0.09
98 0.09
99 0.08
100 0.07
101 0.08
102 0.07
103 0.09
104 0.08
105 0.09
106 0.08
107 0.07
108 0.07
109 0.07
110 0.06
111 0.05
112 0.05
113 0.04
114 0.03
115 0.03
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.02
122 0.02
123 0.02
124 0.03
125 0.03
126 0.03
127 0.04
128 0.05
129 0.1
130 0.13
131 0.15
132 0.15
133 0.16
134 0.17
135 0.19
136 0.18
137 0.14
138 0.14
139 0.13
140 0.15
141 0.14
142 0.13
143 0.11
144 0.12
145 0.12
146 0.11
147 0.11
148 0.1
149 0.11
150 0.12
151 0.12
152 0.12
153 0.12
154 0.1
155 0.1
156 0.09
157 0.07
158 0.11
159 0.11
160 0.12
161 0.14
162 0.22
163 0.26
164 0.29
165 0.31
166 0.28
167 0.32
168 0.32
169 0.34
170 0.33
171 0.29
172 0.28
173 0.26
174 0.26
175 0.22
176 0.22
177 0.17
178 0.17
179 0.2
180 0.26
181 0.33
182 0.4
183 0.5
184 0.55
185 0.62
186 0.66
187 0.73
188 0.76
189 0.79
190 0.83
191 0.82
192 0.88
193 0.9
194 0.89
195 0.88
196 0.82
197 0.83
198 0.83
199 0.84
200 0.84
201 0.85
202 0.86
203 0.84
204 0.85
205 0.82
206 0.77
207 0.72
208 0.68
209 0.63
210 0.55
211 0.52