Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2V5H3M2

Protein Details
Accession A0A2V5H3M2    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
224-254GSTPDRQRRGIKGRSQRERERERGRARRGLVBasic
NLS Segment(s)
PositionSequence
229-252RQRRGIKGRSQRERERERGRARRG
Subcellular Location(s) nucl 12.5, cyto_nucl 8.5, mito 7, extr 4
Family & Domain DBs
Amino Acid Sequences MNPNANRPTTTNTHYQTSLEQDKRLRSRIREERHAALCVLLDRELLTVQALAAQESIPQTRRRFLAKLLSPEDPDTAASLQGDRFVIQHPMRLGSVSGGGASRSGTASPAAAAAAGASPATPSGGDYDEDDRRLRIGVGIGGPITTTGLIVPRQVEEVYETDEAGWRRPPPGGGAERFGAGGGGGGSGTNRGSPAAAGSSVSSPAGRTKAGTTSNSSSVAATAGSTPDRQRRGIKGRSQRERERERGRARRGLVGGAGAAASIFGASLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.39
4 0.41
5 0.47
6 0.41
7 0.43
8 0.43
9 0.51
10 0.56
11 0.61
12 0.6
13 0.56
14 0.64
15 0.69
16 0.73
17 0.73
18 0.73
19 0.73
20 0.69
21 0.65
22 0.54
23 0.45
24 0.37
25 0.29
26 0.24
27 0.16
28 0.13
29 0.11
30 0.11
31 0.1
32 0.09
33 0.08
34 0.06
35 0.06
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.09
42 0.11
43 0.14
44 0.15
45 0.21
46 0.23
47 0.27
48 0.3
49 0.33
50 0.34
51 0.36
52 0.42
53 0.42
54 0.48
55 0.47
56 0.47
57 0.44
58 0.43
59 0.39
60 0.29
61 0.23
62 0.17
63 0.14
64 0.12
65 0.1
66 0.1
67 0.09
68 0.1
69 0.1
70 0.08
71 0.09
72 0.09
73 0.17
74 0.16
75 0.19
76 0.18
77 0.19
78 0.19
79 0.19
80 0.18
81 0.11
82 0.12
83 0.09
84 0.08
85 0.07
86 0.06
87 0.06
88 0.06
89 0.06
90 0.05
91 0.06
92 0.06
93 0.06
94 0.06
95 0.06
96 0.06
97 0.05
98 0.04
99 0.04
100 0.03
101 0.03
102 0.03
103 0.03
104 0.02
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.06
112 0.06
113 0.08
114 0.11
115 0.12
116 0.14
117 0.14
118 0.13
119 0.12
120 0.12
121 0.11
122 0.08
123 0.07
124 0.07
125 0.07
126 0.07
127 0.07
128 0.06
129 0.06
130 0.05
131 0.05
132 0.03
133 0.03
134 0.03
135 0.05
136 0.05
137 0.06
138 0.07
139 0.07
140 0.08
141 0.08
142 0.08
143 0.08
144 0.09
145 0.12
146 0.11
147 0.11
148 0.1
149 0.13
150 0.14
151 0.13
152 0.15
153 0.12
154 0.13
155 0.14
156 0.15
157 0.14
158 0.2
159 0.24
160 0.23
161 0.25
162 0.24
163 0.24
164 0.23
165 0.21
166 0.14
167 0.08
168 0.07
169 0.04
170 0.04
171 0.03
172 0.03
173 0.03
174 0.04
175 0.04
176 0.04
177 0.05
178 0.05
179 0.05
180 0.05
181 0.06
182 0.07
183 0.07
184 0.07
185 0.08
186 0.09
187 0.09
188 0.1
189 0.09
190 0.08
191 0.11
192 0.13
193 0.12
194 0.13
195 0.14
196 0.2
197 0.24
198 0.25
199 0.28
200 0.31
201 0.33
202 0.33
203 0.32
204 0.26
205 0.22
206 0.2
207 0.14
208 0.1
209 0.08
210 0.09
211 0.1
212 0.12
213 0.17
214 0.24
215 0.27
216 0.31
217 0.36
218 0.44
219 0.52
220 0.59
221 0.64
222 0.67
223 0.74
224 0.81
225 0.84
226 0.84
227 0.85
228 0.85
229 0.86
230 0.85
231 0.84
232 0.84
233 0.86
234 0.84
235 0.82
236 0.76
237 0.74
238 0.66
239 0.59
240 0.49
241 0.4
242 0.31
243 0.23
244 0.2
245 0.11
246 0.09
247 0.06
248 0.05
249 0.03