Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D1CAG9

Protein Details
Accession A0A0D1CAG9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
147-175AHSNHASKSSKQKSKRKVRSSARSQTITKHydrophilic
NLS Segment(s)
PositionSequence
156-165SKQKSKRKVR
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0008157  F:protein phosphatase 1 binding  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG uma:UMAG_12142  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MTSGSTNSSSSGAGASQTLTLTATEASRTQATDSDGILHLRPGPGRSASATTSSRRVVWTQETVDNEGLGRKKSKICCIYHRPKAFDESSDESSDSPTDSSSDSDEHSTDSDKDAPNYSKAIKDKLKQPNSNAHHPTHHPHDTCQHAHSNHASKSSKQKSKRKVRSSARSQTITKEQTDGPTDQHHSHADNHAKPFTPNAYERGPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.09
10 0.08
11 0.09
12 0.1
13 0.13
14 0.13
15 0.14
16 0.14
17 0.16
18 0.18
19 0.18
20 0.17
21 0.18
22 0.18
23 0.19
24 0.18
25 0.16
26 0.15
27 0.15
28 0.16
29 0.14
30 0.16
31 0.16
32 0.17
33 0.19
34 0.2
35 0.19
36 0.24
37 0.25
38 0.25
39 0.27
40 0.27
41 0.26
42 0.25
43 0.25
44 0.24
45 0.25
46 0.28
47 0.26
48 0.29
49 0.3
50 0.31
51 0.3
52 0.26
53 0.21
54 0.2
55 0.19
56 0.17
57 0.17
58 0.17
59 0.23
60 0.26
61 0.35
62 0.4
63 0.43
64 0.5
65 0.58
66 0.65
67 0.69
68 0.7
69 0.65
70 0.58
71 0.59
72 0.5
73 0.42
74 0.37
75 0.33
76 0.31
77 0.28
78 0.27
79 0.21
80 0.21
81 0.19
82 0.14
83 0.09
84 0.06
85 0.06
86 0.06
87 0.07
88 0.08
89 0.08
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.1
96 0.09
97 0.1
98 0.13
99 0.13
100 0.14
101 0.17
102 0.18
103 0.18
104 0.19
105 0.19
106 0.2
107 0.21
108 0.27
109 0.29
110 0.32
111 0.4
112 0.48
113 0.57
114 0.56
115 0.58
116 0.61
117 0.61
118 0.67
119 0.61
120 0.53
121 0.48
122 0.47
123 0.48
124 0.45
125 0.47
126 0.39
127 0.37
128 0.41
129 0.43
130 0.42
131 0.4
132 0.39
133 0.33
134 0.36
135 0.4
136 0.4
137 0.36
138 0.42
139 0.4
140 0.37
141 0.48
142 0.54
143 0.57
144 0.6
145 0.68
146 0.71
147 0.81
148 0.88
149 0.86
150 0.87
151 0.89
152 0.9
153 0.91
154 0.9
155 0.86
156 0.81
157 0.73
158 0.69
159 0.67
160 0.6
161 0.51
162 0.44
163 0.38
164 0.37
165 0.39
166 0.34
167 0.28
168 0.3
169 0.33
170 0.32
171 0.34
172 0.31
173 0.3
174 0.32
175 0.38
176 0.41
177 0.43
178 0.46
179 0.46
180 0.45
181 0.43
182 0.44
183 0.4
184 0.38
185 0.35
186 0.35