Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5IWE9

Protein Details
Accession A0A2V5IWE9   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-62NAEMCKREKRWMRKGREEEEBasic
NLS Segment(s)
Subcellular Location(s) extr 9, plas 6, mito 5, E.R. 3, mito_nucl 3
Family & Domain DBs
Amino Acid Sequences MMSVLLFSACWLTGGGGLLISSGESCDKVGGGWRNAHAEREANAEMCKREKRWMRKGREEEEGGGGNAPGIRGETRDQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.06
5 0.06
6 0.05
7 0.05
8 0.04
9 0.04
10 0.04
11 0.05
12 0.05
13 0.05
14 0.05
15 0.05
16 0.11
17 0.15
18 0.17
19 0.18
20 0.19
21 0.24
22 0.24
23 0.25
24 0.21
25 0.17
26 0.16
27 0.18
28 0.18
29 0.14
30 0.14
31 0.15
32 0.15
33 0.19
34 0.21
35 0.19
36 0.27
37 0.35
38 0.44
39 0.53
40 0.62
41 0.67
42 0.75
43 0.82
44 0.78
45 0.76
46 0.69
47 0.6
48 0.54
49 0.46
50 0.35
51 0.27
52 0.23
53 0.16
54 0.13
55 0.11
56 0.07
57 0.08
58 0.08
59 0.1