Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B8N008

Protein Details
Accession B8N008    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
55-80VTEMFKGLSKKKKTKKPKDAEAGEGDHydrophilic
88-113GEFDPTALKKKKKKTKKVDAGDFEAKBasic
NLS Segment(s)
PositionSequence
63-72SKKKKTKKPK
96-104KKKKKKTKK
Subcellular Location(s) cyto 14.5, cyto_nucl 13.333, nucl 11, mito_nucl 6.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR045196  IF2/IF5  
IPR000048  IQ_motif_EF-hand-BS  
IPR002735  Transl_init_fac_IF2/IF5_dom  
IPR016189  Transl_init_fac_IF2/IF5_N  
IPR016190  Transl_init_fac_IF2/IF5_Zn-bd  
Gene Ontology GO:0015629  C:actin cytoskeleton  
GO:0016282  C:eukaryotic 43S preinitiation complex  
GO:0005850  C:eukaryotic translation initiation factor 2 complex  
GO:0043614  C:multi-eIF complex  
GO:0005840  C:ribosome  
GO:0005525  F:GTP binding  
GO:1990856  F:methionyl-initiator methionine tRNA binding  
GO:0003729  F:mRNA binding  
GO:0003743  F:translation initiation factor activity  
GO:0031369  F:translation initiation factor binding  
GO:0001731  P:formation of translation preinitiation complex  
GO:0006996  P:organelle organization  
Pfam View protein in Pfam  
PF01873  eIF-5_eIF-2B  
PROSITE View protein in PROSITE  
PS50096  IQ  
Amino Acid Sequences MADTTVEQAPQKQRKSVAFSEGSVIMDTNGEVTEAPKVEKPTENEATADKSVDEVTEMFKGLSKKKKTKKPKDAEAGEGDEASPAADGEFDPTALKKKKKKTKKVDAGDFEAKLAEAGAAEKGAEETEEVLPEGDLEAGTGIWAHDATQAIPYSLLVSRFFSLIQSHHPDLLSSGAKSYKIPPPQCLREGNRRTIFANIADICKRMKRSDDHVMQFLFAELGTSGSVDGSRRLVIKGRFQQKQLENVLRRYIVEYVTCKTCRSPDTELNKGENRLYFVTCNSCGSRRSVAAIKTGFRGQVGRRKRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.62
3 0.6
4 0.58
5 0.52
6 0.49
7 0.48
8 0.42
9 0.36
10 0.29
11 0.24
12 0.15
13 0.13
14 0.11
15 0.09
16 0.07
17 0.06
18 0.06
19 0.07
20 0.1
21 0.11
22 0.13
23 0.16
24 0.19
25 0.23
26 0.29
27 0.33
28 0.37
29 0.41
30 0.4
31 0.38
32 0.37
33 0.38
34 0.33
35 0.29
36 0.2
37 0.16
38 0.15
39 0.14
40 0.13
41 0.09
42 0.1
43 0.1
44 0.11
45 0.1
46 0.13
47 0.17
48 0.23
49 0.33
50 0.4
51 0.49
52 0.59
53 0.69
54 0.78
55 0.85
56 0.89
57 0.9
58 0.91
59 0.91
60 0.85
61 0.81
62 0.74
63 0.66
64 0.56
65 0.45
66 0.35
67 0.24
68 0.19
69 0.13
70 0.08
71 0.04
72 0.03
73 0.04
74 0.04
75 0.06
76 0.06
77 0.06
78 0.07
79 0.08
80 0.16
81 0.23
82 0.3
83 0.36
84 0.46
85 0.57
86 0.67
87 0.78
88 0.81
89 0.86
90 0.89
91 0.91
92 0.91
93 0.85
94 0.82
95 0.75
96 0.64
97 0.52
98 0.42
99 0.31
100 0.21
101 0.16
102 0.08
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.03
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.04
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.05
133 0.05
134 0.05
135 0.08
136 0.08
137 0.08
138 0.08
139 0.07
140 0.07
141 0.08
142 0.09
143 0.07
144 0.09
145 0.09
146 0.09
147 0.09
148 0.09
149 0.09
150 0.09
151 0.13
152 0.17
153 0.17
154 0.18
155 0.18
156 0.17
157 0.16
158 0.19
159 0.15
160 0.1
161 0.11
162 0.11
163 0.11
164 0.12
165 0.16
166 0.18
167 0.25
168 0.27
169 0.32
170 0.39
171 0.43
172 0.46
173 0.5
174 0.49
175 0.52
176 0.55
177 0.58
178 0.54
179 0.51
180 0.47
181 0.43
182 0.39
183 0.29
184 0.29
185 0.21
186 0.21
187 0.2
188 0.2
189 0.19
190 0.21
191 0.23
192 0.2
193 0.24
194 0.26
195 0.32
196 0.42
197 0.49
198 0.49
199 0.5
200 0.48
201 0.43
202 0.38
203 0.31
204 0.2
205 0.12
206 0.09
207 0.05
208 0.05
209 0.05
210 0.05
211 0.05
212 0.05
213 0.06
214 0.06
215 0.07
216 0.08
217 0.09
218 0.1
219 0.12
220 0.18
221 0.21
222 0.3
223 0.38
224 0.46
225 0.49
226 0.5
227 0.58
228 0.56
229 0.61
230 0.59
231 0.6
232 0.56
233 0.55
234 0.57
235 0.49
236 0.45
237 0.39
238 0.33
239 0.25
240 0.24
241 0.24
242 0.23
243 0.29
244 0.3
245 0.28
246 0.29
247 0.32
248 0.31
249 0.34
250 0.39
251 0.41
252 0.48
253 0.55
254 0.57
255 0.58
256 0.6
257 0.56
258 0.52
259 0.44
260 0.4
261 0.35
262 0.33
263 0.28
264 0.27
265 0.31
266 0.29
267 0.31
268 0.3
269 0.31
270 0.3
271 0.33
272 0.36
273 0.31
274 0.35
275 0.37
276 0.36
277 0.41
278 0.43
279 0.4
280 0.39
281 0.4
282 0.36
283 0.31
284 0.34
285 0.34
286 0.39
287 0.47