Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2V5HJQ5

Protein Details
Accession A0A2V5HJQ5    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-109KRLCDGCKPVRRKNRVYIICSKNPKHKQRQGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
PROSITE View protein in PROSITE  
PS00828  RIBOSOMAL_L36  
Amino Acid Sequences MMSVRSLLGASTGALRQLLPSLSRKPAGLLSRSFSQLAKLPFGNGLRLLRSGQQTGVASATLRQVEQVRGMKTRSSVKRLCDGCKPVRRKNRVYIICSKNPKHKQRQGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.11
5 0.12
6 0.12
7 0.17
8 0.21
9 0.24
10 0.25
11 0.25
12 0.25
13 0.29
14 0.31
15 0.3
16 0.28
17 0.28
18 0.3
19 0.32
20 0.31
21 0.25
22 0.22
23 0.22
24 0.22
25 0.21
26 0.18
27 0.17
28 0.19
29 0.2
30 0.19
31 0.17
32 0.16
33 0.14
34 0.15
35 0.15
36 0.15
37 0.16
38 0.16
39 0.13
40 0.15
41 0.14
42 0.14
43 0.13
44 0.1
45 0.08
46 0.08
47 0.1
48 0.07
49 0.07
50 0.08
51 0.09
52 0.1
53 0.16
54 0.2
55 0.2
56 0.22
57 0.23
58 0.23
59 0.25
60 0.34
61 0.34
62 0.37
63 0.39
64 0.41
65 0.48
66 0.51
67 0.51
68 0.5
69 0.52
70 0.54
71 0.6
72 0.64
73 0.66
74 0.73
75 0.78
76 0.77
77 0.79
78 0.8
79 0.79
80 0.77
81 0.78
82 0.76
83 0.77
84 0.79
85 0.75
86 0.75
87 0.77
88 0.81
89 0.82