Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B8NBG1

Protein Details
Accession B8NBG1   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPRDTWKKDLKKPHRPCIGLBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.333, mito 9, cyto 9, nucl 8.5, cyto_pero 5.665
Family & Domain DBs
Amino Acid Sequences MPRDTWKKDLKKPHRPCIGLLLYYTKERVESLGQVRWDRDLTYDVLAPINLEIGNINGKDYIKGVQRDTACTQLDSEVGVWQKIPQHGTLVWWFGNLGDKVALYNDPVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.8
3 0.73
4 0.72
5 0.66
6 0.56
7 0.47
8 0.42
9 0.34
10 0.33
11 0.32
12 0.22
13 0.17
14 0.16
15 0.17
16 0.14
17 0.17
18 0.2
19 0.23
20 0.26
21 0.27
22 0.27
23 0.27
24 0.25
25 0.2
26 0.18
27 0.15
28 0.14
29 0.14
30 0.14
31 0.12
32 0.12
33 0.11
34 0.1
35 0.07
36 0.07
37 0.05
38 0.04
39 0.04
40 0.04
41 0.06
42 0.06
43 0.06
44 0.07
45 0.07
46 0.07
47 0.08
48 0.1
49 0.14
50 0.16
51 0.17
52 0.21
53 0.22
54 0.26
55 0.27
56 0.3
57 0.25
58 0.23
59 0.23
60 0.19
61 0.18
62 0.14
63 0.13
64 0.11
65 0.1
66 0.1
67 0.1
68 0.11
69 0.15
70 0.17
71 0.18
72 0.16
73 0.19
74 0.19
75 0.22
76 0.23
77 0.23
78 0.2
79 0.18
80 0.17
81 0.15
82 0.21
83 0.18
84 0.16
85 0.14
86 0.14
87 0.14
88 0.16
89 0.16