Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395GLR9

Protein Details
Accession A0A395GLR9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-24LPPSPPDANRLPRRNRPNGAHHydrophilic
NLS Segment(s)
PositionSequence
15-66PRRNRPNGAHPIHVRGPRHNRHPDDHHPLRPSDRRPGRLNPRPIPRAHHAPR
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 6, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036008  Aconitase_4Fe-4S_dom  
Amino Acid Sequences GHHLPPSPPDANRLPRRNRPNGAHPIHVRGPRHNRHPDDHHPLRPSDRRPGRLNPRPIPRAHHAPRSLRGSSNPQARNITWGFGGPGAGIIHQIVLENYVFPGGIDDRDGFAYPERRGDAMAGMGVEVVVPRVIGVRLTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.78
4 0.82
5 0.82
6 0.79
7 0.78
8 0.79
9 0.75
10 0.74
11 0.66
12 0.63
13 0.62
14 0.6
15 0.53
16 0.52
17 0.57
18 0.57
19 0.64
20 0.67
21 0.64
22 0.66
23 0.72
24 0.71
25 0.71
26 0.7
27 0.67
28 0.6
29 0.57
30 0.58
31 0.57
32 0.52
33 0.52
34 0.52
35 0.52
36 0.55
37 0.62
38 0.65
39 0.67
40 0.72
41 0.69
42 0.71
43 0.69
44 0.65
45 0.61
46 0.56
47 0.58
48 0.53
49 0.53
50 0.49
51 0.49
52 0.53
53 0.52
54 0.48
55 0.39
56 0.37
57 0.36
58 0.37
59 0.42
60 0.38
61 0.35
62 0.37
63 0.36
64 0.38
65 0.31
66 0.26
67 0.17
68 0.16
69 0.14
70 0.11
71 0.11
72 0.06
73 0.07
74 0.06
75 0.06
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.05
88 0.05
89 0.07
90 0.06
91 0.06
92 0.08
93 0.09
94 0.1
95 0.11
96 0.12
97 0.11
98 0.15
99 0.19
100 0.19
101 0.22
102 0.23
103 0.22
104 0.22
105 0.22
106 0.19
107 0.15
108 0.15
109 0.11
110 0.09
111 0.08
112 0.08
113 0.07
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.06
120 0.06