Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GVJ7

Protein Details
Accession A0A395GVJ7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
33-55NTNTNNPRSHHLRRRRRLTMLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, extr 5, mito 2, E.R. 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011330  Glyco_hydro/deAcase_b/a-brl  
IPR002509  NODB_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0016810  F:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF01522  Polysacc_deac_1  
PROSITE View protein in PROSITE  
PS51677  NODB  
Amino Acid Sequences MPRLHPTTLLLLPLRLLATPITLLTTLLRSHTNTNTNNPRSHHLRRRRRLTMLLLTLLLLLLLILTPCYLIYRPPISLINYLATRYPDTLWTLPFPPNPSPHNPKLIALTLDDAPSPYTPLLLQTLLTHTSTATFFLIGNQITPQTTPLLTTLVQNGMELGNHAMHDEPSFKLSPTTLRTEITAIDNTIKEIYKSANVERKGKWFRPGSGVFTGWMREMVQELGYRIVLGSVYPHDAQIGWVGLNVWHVGGLSREGSIVVLHDRRGWTVEVLDRVLRVLRGRGYRVVSVGEAMEAAKAAAAAAAAAGGEGGRIGEVVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.15
3 0.14
4 0.1
5 0.1
6 0.11
7 0.1
8 0.1
9 0.1
10 0.1
11 0.11
12 0.13
13 0.12
14 0.14
15 0.16
16 0.17
17 0.21
18 0.28
19 0.35
20 0.36
21 0.45
22 0.54
23 0.56
24 0.59
25 0.58
26 0.58
27 0.58
28 0.66
29 0.66
30 0.67
31 0.73
32 0.78
33 0.85
34 0.86
35 0.84
36 0.81
37 0.78
38 0.76
39 0.7
40 0.61
41 0.51
42 0.43
43 0.36
44 0.28
45 0.19
46 0.1
47 0.05
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.05
56 0.06
57 0.07
58 0.12
59 0.15
60 0.16
61 0.18
62 0.21
63 0.23
64 0.25
65 0.25
66 0.23
67 0.21
68 0.21
69 0.2
70 0.19
71 0.18
72 0.17
73 0.16
74 0.15
75 0.18
76 0.19
77 0.19
78 0.2
79 0.21
80 0.23
81 0.24
82 0.27
83 0.26
84 0.29
85 0.32
86 0.37
87 0.43
88 0.43
89 0.48
90 0.45
91 0.42
92 0.41
93 0.39
94 0.32
95 0.24
96 0.23
97 0.17
98 0.16
99 0.15
100 0.12
101 0.1
102 0.09
103 0.1
104 0.08
105 0.07
106 0.07
107 0.08
108 0.09
109 0.08
110 0.09
111 0.08
112 0.1
113 0.11
114 0.11
115 0.1
116 0.08
117 0.1
118 0.09
119 0.1
120 0.08
121 0.07
122 0.07
123 0.07
124 0.1
125 0.08
126 0.08
127 0.08
128 0.08
129 0.08
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.09
140 0.1
141 0.1
142 0.09
143 0.09
144 0.07
145 0.07
146 0.06
147 0.06
148 0.05
149 0.05
150 0.05
151 0.05
152 0.05
153 0.06
154 0.07
155 0.07
156 0.09
157 0.09
158 0.09
159 0.1
160 0.1
161 0.13
162 0.15
163 0.2
164 0.19
165 0.19
166 0.2
167 0.2
168 0.2
169 0.19
170 0.16
171 0.12
172 0.12
173 0.12
174 0.12
175 0.13
176 0.12
177 0.09
178 0.1
179 0.1
180 0.12
181 0.14
182 0.19
183 0.24
184 0.27
185 0.32
186 0.33
187 0.42
188 0.46
189 0.46
190 0.49
191 0.46
192 0.46
193 0.49
194 0.49
195 0.45
196 0.4
197 0.38
198 0.31
199 0.27
200 0.26
201 0.18
202 0.16
203 0.11
204 0.08
205 0.09
206 0.09
207 0.1
208 0.1
209 0.1
210 0.11
211 0.1
212 0.1
213 0.08
214 0.08
215 0.06
216 0.05
217 0.06
218 0.06
219 0.1
220 0.1
221 0.1
222 0.1
223 0.1
224 0.11
225 0.11
226 0.11
227 0.07
228 0.07
229 0.08
230 0.08
231 0.09
232 0.08
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.08
239 0.07
240 0.07
241 0.08
242 0.08
243 0.08
244 0.08
245 0.08
246 0.12
247 0.13
248 0.14
249 0.17
250 0.18
251 0.19
252 0.21
253 0.21
254 0.17
255 0.19
256 0.22
257 0.22
258 0.23
259 0.23
260 0.2
261 0.2
262 0.2
263 0.19
264 0.17
265 0.18
266 0.22
267 0.27
268 0.31
269 0.35
270 0.38
271 0.37
272 0.37
273 0.35
274 0.29
275 0.25
276 0.21
277 0.16
278 0.12
279 0.1
280 0.09
281 0.07
282 0.06
283 0.05
284 0.05
285 0.04
286 0.04
287 0.04
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.02
295 0.03
296 0.03
297 0.03
298 0.03