Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395HDE0

Protein Details
Accession A0A395HDE0   
Localization Confidence Low
Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MQTGSNNKNEQKRCKKNFPQNSVITHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8, mito 7, cyto 4.5, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MQTGSNNKNEQKRCKKNFPQNSVITHVKEVACATPAMPPPSSSLPIHPAPYLVSSFLRIFQLAIAANIHHFLFFALLSRWNRRRLGPLWSLVRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.87
3 0.89
4 0.92
5 0.89
6 0.86
7 0.81
8 0.76
9 0.71
10 0.65
11 0.55
12 0.45
13 0.41
14 0.31
15 0.27
16 0.23
17 0.17
18 0.14
19 0.12
20 0.11
21 0.13
22 0.15
23 0.17
24 0.16
25 0.16
26 0.18
27 0.2
28 0.23
29 0.18
30 0.17
31 0.2
32 0.21
33 0.22
34 0.18
35 0.16
36 0.14
37 0.15
38 0.14
39 0.1
40 0.09
41 0.1
42 0.11
43 0.12
44 0.12
45 0.1
46 0.1
47 0.09
48 0.1
49 0.08
50 0.08
51 0.08
52 0.07
53 0.08
54 0.09
55 0.09
56 0.06
57 0.06
58 0.06
59 0.06
60 0.06
61 0.07
62 0.07
63 0.14
64 0.19
65 0.28
66 0.34
67 0.39
68 0.42
69 0.43
70 0.5
71 0.47
72 0.51
73 0.49
74 0.52