Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395H3B1

Protein Details
Accession A0A395H3B1    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
72-97SDEPGTPSPRKARKKNPKKAIEEVLSHydrophilic
NLS Segment(s)
PositionSequence
66-90KGKRGVSDEPGTPSPRKARKKNPKK
Subcellular Location(s) nucl 10, cyto_nucl 9.666, mito_nucl 9.166, cyto_mito 8.166, cyto 8, mito 7
Family & Domain DBs
Amino Acid Sequences MTRWTDENKAILLRLIFETQSFTIDPDKIVDAWPTENDKPTAKALSEQLGKYRKSGSSISFSYTKKGKRGVSDEPGTPSPRKARKKNPKKAIEEVLSPVNVGNGAGLDEEHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.16
4 0.14
5 0.17
6 0.15
7 0.17
8 0.15
9 0.14
10 0.15
11 0.16
12 0.16
13 0.14
14 0.15
15 0.13
16 0.14
17 0.13
18 0.12
19 0.13
20 0.15
21 0.19
22 0.19
23 0.2
24 0.21
25 0.22
26 0.22
27 0.23
28 0.22
29 0.17
30 0.18
31 0.18
32 0.21
33 0.23
34 0.21
35 0.25
36 0.29
37 0.29
38 0.28
39 0.29
40 0.24
41 0.24
42 0.26
43 0.22
44 0.22
45 0.22
46 0.24
47 0.27
48 0.27
49 0.27
50 0.3
51 0.3
52 0.29
53 0.34
54 0.35
55 0.35
56 0.41
57 0.44
58 0.47
59 0.47
60 0.45
61 0.43
62 0.43
63 0.4
64 0.36
65 0.33
66 0.34
67 0.41
68 0.49
69 0.54
70 0.63
71 0.71
72 0.81
73 0.88
74 0.9
75 0.9
76 0.88
77 0.86
78 0.84
79 0.76
80 0.68
81 0.6
82 0.53
83 0.43
84 0.36
85 0.28
86 0.19
87 0.15
88 0.12
89 0.09
90 0.05
91 0.06
92 0.06