Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395GJ61

Protein Details
Accession A0A395GJ61    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30KRRRVRKGSRSCWECKRRKIRCRFAAPDDABasic
NLS Segment(s)
Subcellular Location(s) mito 10, nucl 9.5, cyto_nucl 8.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
Amino Acid Sequences KRRRVRKGSRSCWECKRRKIRCRFAAPDDAICIGGQHRRADCVSQEMPEDLSAARRGNRQLGDRIARIEEVMKDW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.83
4 0.83
5 0.87
6 0.9
7 0.9
8 0.89
9 0.9
10 0.86
11 0.81
12 0.79
13 0.71
14 0.61
15 0.51
16 0.41
17 0.32
18 0.25
19 0.19
20 0.1
21 0.11
22 0.12
23 0.13
24 0.13
25 0.14
26 0.15
27 0.16
28 0.16
29 0.2
30 0.18
31 0.16
32 0.17
33 0.16
34 0.16
35 0.14
36 0.15
37 0.08
38 0.1
39 0.11
40 0.12
41 0.14
42 0.17
43 0.2
44 0.25
45 0.29
46 0.31
47 0.35
48 0.41
49 0.44
50 0.43
51 0.43
52 0.39
53 0.35
54 0.32
55 0.29