Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395H483

Protein Details
Accession A0A395H483    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
8-27TPYIKFKRPFPTPHHPPTPRHydrophilic
120-148AIKADRARKKKASKMKKSRRKYRELEDGNBasic
NLS Segment(s)
PositionSequence
121-141IKADRARKKKASKMKKSRRKY
Subcellular Location(s) mito 20, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences MFRSLHLTPYIKFKRPFPTPHHPPTPRLFTLSALSLANKALPPRLKIEDADVIISYLKGTGPGGQKINKTNSAVQLIHKPTGVVVKSQATRSRSQNEKIARQILADKVEQLLHGDQSRAAIKADRARKKKASKMKKSRRKYRELEDGNESPGAEEHDAQDVNDPNEGEALGAEEQSPHQLPSQQHVQQEQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.66
4 0.64
5 0.67
6 0.69
7 0.75
8 0.8
9 0.74
10 0.72
11 0.72
12 0.72
13 0.62
14 0.57
15 0.49
16 0.4
17 0.39
18 0.35
19 0.29
20 0.21
21 0.2
22 0.16
23 0.15
24 0.15
25 0.13
26 0.12
27 0.17
28 0.19
29 0.21
30 0.25
31 0.29
32 0.3
33 0.29
34 0.32
35 0.31
36 0.28
37 0.27
38 0.22
39 0.18
40 0.16
41 0.15
42 0.11
43 0.06
44 0.06
45 0.05
46 0.05
47 0.1
48 0.13
49 0.17
50 0.2
51 0.23
52 0.27
53 0.31
54 0.36
55 0.34
56 0.34
57 0.33
58 0.33
59 0.35
60 0.33
61 0.29
62 0.32
63 0.31
64 0.29
65 0.26
66 0.22
67 0.18
68 0.22
69 0.21
70 0.13
71 0.13
72 0.16
73 0.18
74 0.21
75 0.25
76 0.23
77 0.27
78 0.3
79 0.35
80 0.36
81 0.37
82 0.4
83 0.4
84 0.42
85 0.41
86 0.4
87 0.33
88 0.29
89 0.29
90 0.25
91 0.23
92 0.18
93 0.15
94 0.13
95 0.13
96 0.12
97 0.12
98 0.1
99 0.09
100 0.1
101 0.1
102 0.09
103 0.11
104 0.12
105 0.11
106 0.11
107 0.11
108 0.13
109 0.2
110 0.3
111 0.37
112 0.41
113 0.48
114 0.56
115 0.62
116 0.69
117 0.72
118 0.74
119 0.76
120 0.83
121 0.87
122 0.89
123 0.92
124 0.93
125 0.92
126 0.91
127 0.87
128 0.84
129 0.84
130 0.79
131 0.73
132 0.69
133 0.61
134 0.54
135 0.47
136 0.38
137 0.27
138 0.22
139 0.2
140 0.13
141 0.12
142 0.11
143 0.14
144 0.15
145 0.14
146 0.19
147 0.19
148 0.19
149 0.21
150 0.2
151 0.16
152 0.16
153 0.16
154 0.11
155 0.08
156 0.09
157 0.07
158 0.08
159 0.07
160 0.08
161 0.08
162 0.13
163 0.14
164 0.12
165 0.14
166 0.2
167 0.22
168 0.27
169 0.37
170 0.37
171 0.4