Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395GJ88

Protein Details
Accession A0A395GJ88    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-112LPSPNFAKRVCRKRSSRANGELLRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 5, plas 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFCSLLHSGSIVRLSAVGIIRMLGSQYYVVGWVIPTWRRTRKKLSLLRISFDRQVGALEAADISRAVTGVGSFTLESLGCPVGRVRTILPSPNFAKRVCRKRSSRANGELLRDFRMAIPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.13
3 0.13
4 0.11
5 0.09
6 0.1
7 0.1
8 0.09
9 0.09
10 0.06
11 0.06
12 0.05
13 0.06
14 0.05
15 0.06
16 0.06
17 0.05
18 0.06
19 0.06
20 0.09
21 0.12
22 0.15
23 0.21
24 0.31
25 0.37
26 0.43
27 0.52
28 0.58
29 0.65
30 0.71
31 0.73
32 0.74
33 0.7
34 0.68
35 0.62
36 0.55
37 0.47
38 0.39
39 0.3
40 0.19
41 0.17
42 0.14
43 0.11
44 0.08
45 0.05
46 0.05
47 0.05
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.04
59 0.04
60 0.04
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.09
70 0.1
71 0.11
72 0.11
73 0.16
74 0.19
75 0.25
76 0.26
77 0.3
78 0.33
79 0.39
80 0.41
81 0.35
82 0.43
83 0.46
84 0.55
85 0.58
86 0.64
87 0.64
88 0.72
89 0.82
90 0.82
91 0.82
92 0.8
93 0.81
94 0.76
95 0.75
96 0.72
97 0.63
98 0.57
99 0.47
100 0.4