Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GK50

Protein Details
Accession A0A395GK50    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-26RDPPHPPPHNSPNKHRSHRASBasic
NLS Segment(s)
Subcellular Location(s) mito 25
Family & Domain DBs
Amino Acid Sequences MIIGGRDPPHPPPHNSPNKHRSHRASLLARHSIRLSTSPRLVACWKMTILLGNCFARSCSLRPEGEYGAVAVGYSFCSQLAFFWSEDAAVEVFAEECLEVAKLGAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.69
3 0.73
4 0.74
5 0.79
6 0.8
7 0.8
8 0.77
9 0.75
10 0.76
11 0.75
12 0.72
13 0.68
14 0.67
15 0.67
16 0.6
17 0.52
18 0.46
19 0.37
20 0.31
21 0.3
22 0.27
23 0.23
24 0.24
25 0.25
26 0.25
27 0.26
28 0.27
29 0.25
30 0.22
31 0.19
32 0.17
33 0.15
34 0.15
35 0.16
36 0.15
37 0.14
38 0.15
39 0.14
40 0.14
41 0.13
42 0.13
43 0.12
44 0.13
45 0.12
46 0.14
47 0.18
48 0.18
49 0.19
50 0.22
51 0.22
52 0.21
53 0.19
54 0.15
55 0.11
56 0.1
57 0.09
58 0.05
59 0.04
60 0.05
61 0.05
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.1
68 0.11
69 0.11
70 0.11
71 0.11
72 0.11
73 0.11
74 0.12
75 0.08
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.06
82 0.04
83 0.04
84 0.05
85 0.05
86 0.05