Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395GJM9

Protein Details
Accession A0A395GJM9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-45PQDRDLTSRTRREKRRRVRHQKSRKGCYTCKBasic
NLS Segment(s)
PositionSequence
24-39TRREKRRRVRHQKSRK
Subcellular Location(s) nucl 19.5, cyto_nucl 15, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSNSSSPPATEMSEPQDRDLTSRTRREKRRRVRHQKSRKGCYTCKMRRVKVGDILISIHWNRPSDPSRAVR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.3
4 0.28
5 0.28
6 0.29
7 0.3
8 0.31
9 0.39
10 0.47
11 0.53
12 0.64
13 0.72
14 0.79
15 0.83
16 0.87
17 0.9
18 0.92
19 0.94
20 0.95
21 0.95
22 0.95
23 0.93
24 0.91
25 0.88
26 0.83
27 0.75
28 0.72
29 0.72
30 0.7
31 0.69
32 0.69
33 0.64
34 0.65
35 0.67
36 0.64
37 0.61
38 0.57
39 0.49
40 0.41
41 0.4
42 0.32
43 0.31
44 0.27
45 0.23
46 0.22
47 0.22
48 0.22
49 0.28
50 0.31
51 0.32