Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GYG8

Protein Details
Accession A0A395GYG8    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
342-367DDLRRERCRQRVTSQRRPQKNVYAQYHydrophilic
NLS Segment(s)
PositionSequence
318-338RQRSGAKGGKATKIKARFRGR
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001766  Fork_head_dom  
IPR000048  IQ_motif_EF-hand-BS  
IPR030456  TF_fork_head_CS_2  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0015629  C:actin cytoskeleton  
GO:0005634  C:nucleus  
GO:0003700  F:DNA-binding transcription factor activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0006996  P:organelle organization  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF00250  Forkhead  
PROSITE View protein in PROSITE  
PS00658  FORK_HEAD_2  
PS50039  FORK_HEAD_3  
PS50096  IQ  
CDD cd20032  FH_FOXO  
Amino Acid Sequences MDRFFPPHGLPSDSLPFGRGLVDVARQTVAPPASVSDGVRLDPSHHRDPCSAIGNWTSSSSSSPAEPMSLSHHQQNPWKMALPPSLPAPISFPDRGLPRLLPSHRLEVPEGPSSLLAAGGSRSRQLKPELRRLHDSRPSSDWLREPGAISSCSHESSSYHLSTGMARSDTSETACPTANLPPLSPAVSALTYPSLKLDQSDASDTIDEKPYSKLIEMALKTNPEKKLSLQGIYNWFEQNTAKGRDQSSKGWQNSVRHNLSMNAGFEAVREEPIPGKKAVNYWRLTNEAIENGVQSTTRYRKQASYRKALGSDPLAPQRQRSGAKGGKATKIKARFRGRMSEDDLRRERCRQRVTSQRRPQKNVYAQYCTTAAALTGITVVSPYQVSGPTTPGTRLSTEPFDLGSVVGCADPSPCTPLFCDMAGSGPDCVALDSGFLGWGAIHSFPTGLLAGSGISADIQMGGIA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.29
3 0.26
4 0.22
5 0.21
6 0.16
7 0.12
8 0.12
9 0.17
10 0.17
11 0.18
12 0.18
13 0.17
14 0.17
15 0.21
16 0.2
17 0.16
18 0.15
19 0.15
20 0.18
21 0.2
22 0.2
23 0.19
24 0.19
25 0.19
26 0.2
27 0.19
28 0.2
29 0.27
30 0.34
31 0.39
32 0.41
33 0.44
34 0.44
35 0.48
36 0.5
37 0.47
38 0.41
39 0.34
40 0.34
41 0.33
42 0.32
43 0.29
44 0.24
45 0.19
46 0.2
47 0.19
48 0.17
49 0.15
50 0.16
51 0.15
52 0.15
53 0.14
54 0.13
55 0.18
56 0.23
57 0.24
58 0.3
59 0.34
60 0.37
61 0.44
62 0.5
63 0.47
64 0.44
65 0.45
66 0.39
67 0.4
68 0.42
69 0.37
70 0.32
71 0.3
72 0.3
73 0.28
74 0.26
75 0.24
76 0.21
77 0.25
78 0.23
79 0.21
80 0.23
81 0.25
82 0.26
83 0.26
84 0.24
85 0.22
86 0.3
87 0.31
88 0.34
89 0.34
90 0.39
91 0.39
92 0.4
93 0.38
94 0.34
95 0.36
96 0.33
97 0.31
98 0.25
99 0.22
100 0.2
101 0.17
102 0.13
103 0.09
104 0.05
105 0.06
106 0.08
107 0.08
108 0.11
109 0.15
110 0.15
111 0.19
112 0.26
113 0.34
114 0.4
115 0.5
116 0.55
117 0.58
118 0.65
119 0.66
120 0.68
121 0.68
122 0.64
123 0.57
124 0.52
125 0.52
126 0.46
127 0.45
128 0.38
129 0.34
130 0.33
131 0.3
132 0.27
133 0.24
134 0.24
135 0.21
136 0.19
137 0.19
138 0.17
139 0.17
140 0.17
141 0.15
142 0.13
143 0.17
144 0.21
145 0.19
146 0.17
147 0.17
148 0.17
149 0.18
150 0.19
151 0.16
152 0.11
153 0.11
154 0.12
155 0.14
156 0.14
157 0.14
158 0.14
159 0.13
160 0.14
161 0.14
162 0.13
163 0.12
164 0.15
165 0.17
166 0.16
167 0.15
168 0.16
169 0.16
170 0.17
171 0.16
172 0.13
173 0.1
174 0.1
175 0.1
176 0.09
177 0.1
178 0.09
179 0.09
180 0.1
181 0.09
182 0.09
183 0.09
184 0.11
185 0.09
186 0.11
187 0.13
188 0.12
189 0.12
190 0.13
191 0.13
192 0.13
193 0.15
194 0.13
195 0.12
196 0.13
197 0.13
198 0.14
199 0.13
200 0.13
201 0.1
202 0.16
203 0.16
204 0.17
205 0.18
206 0.2
207 0.21
208 0.25
209 0.25
210 0.21
211 0.22
212 0.2
213 0.27
214 0.27
215 0.27
216 0.23
217 0.25
218 0.28
219 0.3
220 0.3
221 0.22
222 0.2
223 0.19
224 0.18
225 0.17
226 0.17
227 0.18
228 0.18
229 0.21
230 0.23
231 0.27
232 0.3
233 0.31
234 0.35
235 0.39
236 0.39
237 0.41
238 0.43
239 0.43
240 0.47
241 0.52
242 0.45
243 0.37
244 0.37
245 0.33
246 0.31
247 0.29
248 0.22
249 0.14
250 0.13
251 0.12
252 0.11
253 0.12
254 0.1
255 0.08
256 0.08
257 0.08
258 0.11
259 0.13
260 0.16
261 0.15
262 0.15
263 0.16
264 0.22
265 0.29
266 0.33
267 0.33
268 0.33
269 0.35
270 0.36
271 0.36
272 0.31
273 0.25
274 0.17
275 0.17
276 0.14
277 0.12
278 0.09
279 0.09
280 0.08
281 0.07
282 0.12
283 0.17
284 0.2
285 0.23
286 0.25
287 0.32
288 0.42
289 0.51
290 0.53
291 0.58
292 0.59
293 0.59
294 0.59
295 0.53
296 0.45
297 0.39
298 0.35
299 0.29
300 0.3
301 0.32
302 0.3
303 0.31
304 0.32
305 0.35
306 0.33
307 0.32
308 0.35
309 0.35
310 0.39
311 0.45
312 0.46
313 0.47
314 0.48
315 0.49
316 0.47
317 0.52
318 0.54
319 0.57
320 0.62
321 0.61
322 0.62
323 0.68
324 0.66
325 0.62
326 0.63
327 0.62
328 0.57
329 0.58
330 0.6
331 0.56
332 0.55
333 0.57
334 0.57
335 0.56
336 0.62
337 0.59
338 0.63
339 0.68
340 0.75
341 0.78
342 0.81
343 0.82
344 0.83
345 0.84
346 0.82
347 0.81
348 0.8
349 0.79
350 0.74
351 0.71
352 0.62
353 0.58
354 0.52
355 0.42
356 0.33
357 0.23
358 0.16
359 0.1
360 0.09
361 0.06
362 0.06
363 0.05
364 0.05
365 0.05
366 0.05
367 0.05
368 0.05
369 0.05
370 0.06
371 0.08
372 0.1
373 0.11
374 0.14
375 0.15
376 0.17
377 0.18
378 0.2
379 0.21
380 0.22
381 0.23
382 0.25
383 0.28
384 0.28
385 0.27
386 0.24
387 0.22
388 0.2
389 0.17
390 0.13
391 0.09
392 0.08
393 0.07
394 0.06
395 0.06
396 0.07
397 0.08
398 0.09
399 0.14
400 0.14
401 0.15
402 0.17
403 0.21
404 0.22
405 0.21
406 0.22
407 0.17
408 0.19
409 0.19
410 0.19
411 0.15
412 0.13
413 0.13
414 0.11
415 0.11
416 0.09
417 0.07
418 0.07
419 0.07
420 0.07
421 0.07
422 0.06
423 0.06
424 0.05
425 0.06
426 0.07
427 0.07
428 0.08
429 0.08
430 0.08
431 0.08
432 0.1
433 0.1
434 0.08
435 0.07
436 0.07
437 0.07
438 0.07
439 0.07
440 0.05
441 0.05
442 0.05
443 0.05
444 0.05