Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A395H056

Protein Details
Accession A0A395H056    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
26-51PATAPKPKTPTPPKPPKPTPEHKKSSHydrophilic
NLS Segment(s)
PositionSequence
9-49ARPPQKSPAGGTPAKPKPATAPKPKTPTPPKPPKPTPEHKK
Subcellular Location(s) nucl 14.5, mito_nucl 11.666, cyto_nucl 9.333, mito 7.5, cyto 2, pero 2
Family & Domain DBs
Amino Acid Sequences MVKPENKLARPPQKSPAGGTPAKPKPATAPKPKTPTPPKPPKPTPEHKKSSSTVKSTSNVNKPTTSTLLDPERNLWEEAWMSVDVGEANRKRLTQKWHAKNLNRVGKLPKENECSGRWKPRSTLLYFWLDILGSRRIITGCI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.59
4 0.56
5 0.52
6 0.51
7 0.53
8 0.5
9 0.54
10 0.49
11 0.42
12 0.44
13 0.52
14 0.57
15 0.58
16 0.62
17 0.64
18 0.71
19 0.74
20 0.76
21 0.75
22 0.76
23 0.76
24 0.78
25 0.79
26 0.82
27 0.85
28 0.84
29 0.83
30 0.83
31 0.82
32 0.81
33 0.8
34 0.74
35 0.72
36 0.66
37 0.67
38 0.62
39 0.56
40 0.5
41 0.46
42 0.44
43 0.44
44 0.48
45 0.46
46 0.44
47 0.41
48 0.39
49 0.36
50 0.37
51 0.33
52 0.27
53 0.2
54 0.19
55 0.22
56 0.23
57 0.22
58 0.21
59 0.2
60 0.2
61 0.2
62 0.16
63 0.12
64 0.11
65 0.1
66 0.11
67 0.09
68 0.07
69 0.07
70 0.07
71 0.06
72 0.06
73 0.12
74 0.11
75 0.14
76 0.15
77 0.16
78 0.18
79 0.23
80 0.31
81 0.36
82 0.46
83 0.52
84 0.62
85 0.7
86 0.73
87 0.77
88 0.79
89 0.78
90 0.69
91 0.63
92 0.59
93 0.58
94 0.59
95 0.55
96 0.52
97 0.5
98 0.51
99 0.52
100 0.49
101 0.49
102 0.5
103 0.56
104 0.53
105 0.5
106 0.5
107 0.55
108 0.59
109 0.55
110 0.53
111 0.48
112 0.5
113 0.46
114 0.43
115 0.35
116 0.28
117 0.24
118 0.22
119 0.2
120 0.15
121 0.15
122 0.16