Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GYU9

Protein Details
Accession A0A395GYU9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
104-123QGNSPKERKREVRGKDGRPRBasic
NLS Segment(s)
PositionSequence
107-123SPKERKREVRGKDGRPR
Subcellular Location(s) extr 9, mito 6, plas 5, E.R. 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPLADDNHNNLSRGKMNIFSFLSIFAVKEIFFSLSVCSFAFSFSFFRSGMMSGTAKVLIGLKYSNGDTSDPRHGRAGRSGEDPTAGGEVQVTTQIAQGKVMRQGNSPKERKREVRGKDGRPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.28
4 0.27
5 0.32
6 0.32
7 0.29
8 0.26
9 0.23
10 0.22
11 0.17
12 0.16
13 0.1
14 0.1
15 0.08
16 0.08
17 0.09
18 0.08
19 0.08
20 0.08
21 0.09
22 0.09
23 0.1
24 0.1
25 0.09
26 0.08
27 0.09
28 0.08
29 0.09
30 0.1
31 0.09
32 0.11
33 0.11
34 0.11
35 0.11
36 0.12
37 0.1
38 0.11
39 0.11
40 0.09
41 0.1
42 0.09
43 0.08
44 0.08
45 0.09
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.07
52 0.08
53 0.08
54 0.09
55 0.09
56 0.13
57 0.22
58 0.22
59 0.23
60 0.27
61 0.28
62 0.28
63 0.34
64 0.34
65 0.27
66 0.3
67 0.3
68 0.25
69 0.25
70 0.23
71 0.17
72 0.14
73 0.11
74 0.08
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.06
81 0.08
82 0.11
83 0.11
84 0.14
85 0.15
86 0.17
87 0.24
88 0.28
89 0.28
90 0.29
91 0.38
92 0.46
93 0.54
94 0.61
95 0.61
96 0.66
97 0.73
98 0.77
99 0.78
100 0.78
101 0.75
102 0.78
103 0.8