Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A395GYS4

Protein Details
Accession A0A395GYS4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
69-91LRAVPKKKTSHMKKRHRQMAGKABasic
NLS Segment(s)
PositionSequence
73-90PKKKTSHMKKRHRQMAGK
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MALRLLPSSLSAQMLPRTRLLTDSLSAAAVGPWSAFAINASAWSHNFLKPAAISLNIPGLIEGLWDSVLRAVPKKKTSHMKKRHRQMAGKALKDVKGLSTCSGCGQVKRSHVLCPNCVESVKKQWKDTQTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.27
4 0.27
5 0.26
6 0.27
7 0.27
8 0.24
9 0.2
10 0.2
11 0.18
12 0.16
13 0.15
14 0.14
15 0.11
16 0.08
17 0.07
18 0.05
19 0.04
20 0.04
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.07
27 0.08
28 0.08
29 0.09
30 0.13
31 0.14
32 0.14
33 0.15
34 0.14
35 0.14
36 0.13
37 0.14
38 0.11
39 0.1
40 0.1
41 0.09
42 0.11
43 0.09
44 0.09
45 0.07
46 0.07
47 0.06
48 0.05
49 0.05
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.06
57 0.09
58 0.13
59 0.18
60 0.23
61 0.26
62 0.32
63 0.41
64 0.51
65 0.59
66 0.67
67 0.73
68 0.78
69 0.85
70 0.88
71 0.85
72 0.81
73 0.78
74 0.78
75 0.75
76 0.68
77 0.62
78 0.56
79 0.49
80 0.44
81 0.36
82 0.29
83 0.23
84 0.22
85 0.2
86 0.18
87 0.17
88 0.18
89 0.23
90 0.21
91 0.21
92 0.25
93 0.28
94 0.31
95 0.37
96 0.37
97 0.38
98 0.45
99 0.47
100 0.46
101 0.46
102 0.46
103 0.41
104 0.42
105 0.38
106 0.36
107 0.42
108 0.49
109 0.49
110 0.5
111 0.56